BLASTX nr result
ID: Atractylodes22_contig00024729
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00024729 (217 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510696.1| calcium ion binding protein, putative [Ricin... 54 1e-05 >ref|XP_002510696.1| calcium ion binding protein, putative [Ricinus communis] gi|223551397|gb|EEF52883.1| calcium ion binding protein, putative [Ricinus communis] Length = 1006 Score = 54.3 bits (129), Expect = 1e-05 Identities = 33/80 (41%), Positives = 40/80 (50%), Gaps = 9/80 (11%) Frame = +2 Query: 2 PQINLGALPVTQSNFNAAPPALQMHGSAPAASNSMGIRGP---------QGYPSQQSQDM 154 P+INL A PV Q N P A QM P S+G RGP Q +PS QSQ M Sbjct: 100 PKINLLATPVQQVNPMMTPSAPQMGAPPPTPVQSLGFRGPGLPNAGINQQYFPSPQSQTM 159 Query: 155 RPHVALLPNSTLQPQHGVTH 214 RP A+ P +P G+T+ Sbjct: 160 RPPQAIPPGIASRPTQGITN 179