BLASTX nr result
ID: Atractylodes22_contig00024406
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00024406 (295 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003524546.1| PREDICTED: uncharacterized protein LOC100784... 65 6e-09 ref|XP_003618262.1| Serine/threonine protein kinase [Medicago tr... 60 2e-07 ref|XP_003553828.1| PREDICTED: uncharacterized protein LOC100778... 57 2e-06 ref|XP_003553827.1| PREDICTED: uncharacterized protein LOC100778... 57 2e-06 gb|ABS32235.1| protein kinase [Carica papaya] 57 2e-06 >ref|XP_003524546.1| PREDICTED: uncharacterized protein LOC100784402 [Glycine max] Length = 669 Score = 65.1 bits (157), Expect = 6e-09 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = -1 Query: 292 PPTPRERALHSQVIQLQQSIGSLVEQLQRQKMRNAQVEKKL 170 P T RER LH QVIQLQQSIGSLVE+LQRQKM+N Q+EK+L Sbjct: 620 PATTRERELHFQVIQLQQSIGSLVEELQRQKMKNVQLEKQL 660 >ref|XP_003618262.1| Serine/threonine protein kinase [Medicago truncatula] gi|355493277|gb|AES74480.1| Serine/threonine protein kinase [Medicago truncatula] Length = 667 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/41 (68%), Positives = 36/41 (87%) Frame = -1 Query: 292 PPTPRERALHSQVIQLQQSIGSLVEQLQRQKMRNAQVEKKL 170 P + RE+ LH QVIQLQQSIGSLVE+LQRQK++N Q+E++L Sbjct: 618 PVSTREKELHLQVIQLQQSIGSLVEELQRQKLKNVQLERQL 658 >ref|XP_003553828.1| PREDICTED: uncharacterized protein LOC100778837 isoform 2 [Glycine max] Length = 664 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -1 Query: 292 PPTPRERALHSQVIQLQQSIGSLVEQLQRQKMRNAQVEKKL 170 P T RER LH QVIQLQQS G L E+LQ+QKM+N Q+EK+L Sbjct: 615 PATTRERELHFQVIQLQQSNGILFEELQKQKMKNVQLEKQL 655 >ref|XP_003553827.1| PREDICTED: uncharacterized protein LOC100778837 isoform 1 [Glycine max] Length = 671 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -1 Query: 292 PPTPRERALHSQVIQLQQSIGSLVEQLQRQKMRNAQVEKKL 170 P T RER LH QVIQLQQS G L E+LQ+QKM+N Q+EK+L Sbjct: 622 PATTRERELHFQVIQLQQSNGILFEELQKQKMKNVQLEKQL 662 >gb|ABS32235.1| protein kinase [Carica papaya] Length = 684 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -1 Query: 292 PPTPRERALHSQVIQLQQSIGSLVEQLQRQKMRNAQV 182 P TPRER L SQ+IQLQQSIGSL+E+LQ QKM+N QV Sbjct: 644 PSTPRERELVSQMIQLQQSIGSLIEELQTQKMKNHQV 680