BLASTX nr result
ID: Atractylodes22_contig00024358
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00024358 (422 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515332.1| conserved hypothetical protein [Ricinus comm... 103 1e-20 >ref|XP_002515332.1| conserved hypothetical protein [Ricinus communis] gi|223545812|gb|EEF47316.1| conserved hypothetical protein [Ricinus communis] Length = 171 Score = 103 bits (257), Expect = 1e-20 Identities = 52/76 (68%), Positives = 59/76 (77%), Gaps = 1/76 (1%) Frame = +2 Query: 197 LKYVHKLEFLKFDEPNPRIWIK-CCKYFMLCKIPDGQLVDLASLNIVDKAENWISSYLSV 373 L Y+ KL+F KFD N R WIK CCKYF+ CKIPD Q VDLASLN+VDKAENW+SSYL Sbjct: 29 LGYIPKLKFPKFDGSNLRQWIKKCCKYFVFCKIPDKQKVDLASLNMVDKAENWVSSYLIN 88 Query: 374 WKYVDLNDFVIDLNAR 421 VD NDFVID+N+R Sbjct: 89 RTAVDWNDFVIDVNSR 104