BLASTX nr result
ID: Atractylodes22_contig00024261
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00024261 (551 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI16338.3| unnamed protein product [Vitis vinifera] 59 7e-07 >emb|CBI16338.3| unnamed protein product [Vitis vinifera] Length = 1452 Score = 58.5 bits (140), Expect = 7e-07 Identities = 29/45 (64%), Positives = 34/45 (75%), Gaps = 1/45 (2%) Frame = +1 Query: 418 DLSVPSGPRVAESIWDTREVELSDSEGSQK-KQYFVKYEGLAHIH 549 +L V + ESIWDTREVEL +EG QK KQYFVKY+GLAH+H Sbjct: 496 ELGVHAVSEGVESIWDTREVELPSAEGVQKQKQYFVKYKGLAHVH 540