BLASTX nr result
ID: Atractylodes22_contig00024231
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00024231 (457 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519675.1| cullin, putative [Ricinus communis] gi|22354... 95 3e-30 ref|NP_001234356.1| cullin 4 [Solanum lycopersicum] gi|159895408... 91 4e-29 ref|XP_002863417.1| hypothetical protein ARALYDRAFT_916814 [Arab... 87 9e-28 gb|AAS21017.1| cullin [Hyacinthus orientalis] 87 1e-27 gb|AAM14063.1| putative cullin [Arabidopsis thaliana] 87 1e-27 >ref|XP_002519675.1| cullin, putative [Ricinus communis] gi|223541092|gb|EEF42648.1| cullin, putative [Ricinus communis] Length = 807 Score = 94.7 bits (234), Expect(3) = 3e-30 Identities = 45/58 (77%), Positives = 51/58 (87%) Frame = -2 Query: 174 KDIKDATSIEDNELRRTLQSLACGKVRFLQKIPKGGEVDDNDYFMFNGGFTAPLYSIK 1 +DIKDAT IED ELRRTLQSLACGKVR LQK+PKG +V+D+D F+FN GFTAPLY IK Sbjct: 682 QDIKDATGIEDKELRRTLQSLACGKVRVLQKLPKGRDVEDDDSFVFNEGFTAPLYRIK 739 Score = 48.9 bits (115), Expect(3) = 3e-30 Identities = 20/27 (74%), Positives = 23/27 (85%) Frame = -3 Query: 305 VTMISPRYWPTYPPMDVRLPH*LNVYQ 225 V +++ YWPTYPPMDVRLPH LNVYQ Sbjct: 596 VHVLTTGYWPTYPPMDVRLPHELNVYQ 622 Score = 33.5 bits (75), Expect(3) = 3e-30 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 214 FYLSKYNGRRLMWQ 173 FYLSKY+GRRLMWQ Sbjct: 628 FYLSKYSGRRLMWQ 641 >ref|NP_001234356.1| cullin 4 [Solanum lycopersicum] gi|159895408|gb|ABX09988.1| cullin 4 [Solanum lycopersicum] Length = 785 Score = 91.3 bits (225), Expect(3) = 4e-29 Identities = 44/58 (75%), Positives = 50/58 (86%) Frame = -2 Query: 174 KDIKDATSIEDNELRRTLQSLACGKVRFLQKIPKGGEVDDNDYFMFNGGFTAPLYSIK 1 +DIK+AT IED ELRRTLQSLACGKVR LQKIPKG +V+D+D F+FN FTAPLY IK Sbjct: 637 QDIKEATGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIK 694 Score = 48.5 bits (114), Expect(3) = 4e-29 Identities = 20/27 (74%), Positives = 23/27 (85%) Frame = -3 Query: 305 VTMISPRYWPTYPPMDVRLPH*LNVYQ 225 V +++ YWPTYPPMDVRLPH LNVYQ Sbjct: 551 VHVLTMGYWPTYPPMDVRLPHELNVYQ 577 Score = 33.5 bits (75), Expect(3) = 4e-29 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 214 FYLSKYNGRRLMWQ 173 FYLSKY+GRRLMWQ Sbjct: 583 FYLSKYSGRRLMWQ 596 >ref|XP_002863417.1| hypothetical protein ARALYDRAFT_916814 [Arabidopsis lyrata subsp. lyrata] gi|297309252|gb|EFH39676.1| hypothetical protein ARALYDRAFT_916814 [Arabidopsis lyrata subsp. lyrata] Length = 791 Score = 87.4 bits (215), Expect(3) = 9e-28 Identities = 43/58 (74%), Positives = 47/58 (81%) Frame = -2 Query: 174 KDIKDATSIEDNELRRTLQSLACGKVRFLQKIPKGGEVDDNDYFMFNGGFTAPLYSIK 1 +DIKD+TSIED ELRRTLQSLACGKVR LQK PKG +V+D D F FN F APLY IK Sbjct: 643 EDIKDSTSIEDKELRRTLQSLACGKVRVLQKNPKGRDVEDGDEFEFNDDFAAPLYRIK 700 Score = 47.8 bits (112), Expect(3) = 9e-28 Identities = 19/27 (70%), Positives = 23/27 (85%) Frame = -3 Query: 305 VTMISPRYWPTYPPMDVRLPH*LNVYQ 225 V +++ YWPTYPPMDV+LPH LNVYQ Sbjct: 557 VHVLTTGYWPTYPPMDVKLPHELNVYQ 583 Score = 33.5 bits (75), Expect(3) = 9e-28 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 214 FYLSKYNGRRLMWQ 173 FYLSKY+GRRLMWQ Sbjct: 589 FYLSKYSGRRLMWQ 602 >gb|AAS21017.1| cullin [Hyacinthus orientalis] Length = 270 Score = 87.0 bits (214), Expect(3) = 1e-27 Identities = 42/57 (73%), Positives = 48/57 (84%) Frame = -2 Query: 174 KDIKDATSIEDNELRRTLQSLACGKVRFLQKIPKGGEVDDNDYFMFNGGFTAPLYSI 4 +DIKD+TSI+D ELRRTLQSLACGK R LQK PKG EVDD+D F+FN F+APLY I Sbjct: 178 QDIKDSTSIDDKELRRTLQSLACGKFRVLQKYPKGREVDDDDSFVFNEEFSAPLYRI 234 Score = 48.1 bits (113), Expect(3) = 1e-27 Identities = 19/27 (70%), Positives = 23/27 (85%) Frame = -3 Query: 305 VTMISPRYWPTYPPMDVRLPH*LNVYQ 225 V +++ YWPTYPPMDV+LPH LNVYQ Sbjct: 92 VLVLTTGYWPTYPPMDVKLPHELNVYQ 118 Score = 33.5 bits (75), Expect(3) = 1e-27 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 214 FYLSKYNGRRLMWQ 173 FYLSKY+GRRLMWQ Sbjct: 124 FYLSKYSGRRLMWQ 137 >gb|AAM14063.1| putative cullin [Arabidopsis thaliana] Length = 792 Score = 87.0 bits (214), Expect(3) = 1e-27 Identities = 43/58 (74%), Positives = 47/58 (81%) Frame = -2 Query: 174 KDIKDATSIEDNELRRTLQSLACGKVRFLQKIPKGGEVDDNDYFMFNGGFTAPLYSIK 1 +DIKD+TSIED ELRRTLQSLACGKVR LQK PKG +V+D D F FN F APLY IK Sbjct: 644 EDIKDSTSIEDKELRRTLQSLACGKVRVLQKNPKGRDVEDGDEFEFNDEFAAPLYRIK 701 Score = 47.8 bits (112), Expect(3) = 1e-27 Identities = 19/27 (70%), Positives = 23/27 (85%) Frame = -3 Query: 305 VTMISPRYWPTYPPMDVRLPH*LNVYQ 225 V +++ YWPTYPPMDV+LPH LNVYQ Sbjct: 558 VHVLTTGYWPTYPPMDVKLPHELNVYQ 584 Score = 33.5 bits (75), Expect(3) = 1e-27 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 214 FYLSKYNGRRLMWQ 173 FYLSKY+GRRLMWQ Sbjct: 590 FYLSKYSGRRLMWQ 603