BLASTX nr result
ID: Atractylodes22_contig00024090
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00024090 (337 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526854.1| peroxisomal membrane protein pmp34, putative... 57 2e-12 ref|XP_002279488.2| PREDICTED: mitochondrial substrate carrier f... 58 3e-12 emb|CBI31533.3| unnamed protein product [Vitis vinifera] 58 3e-12 ref|XP_003616573.1| Peroxisomal membrane protein [Medicago trunc... 54 2e-11 ref|XP_002315175.1| predicted protein [Populus trichocarpa] gi|2... 57 7e-11 >ref|XP_002526854.1| peroxisomal membrane protein pmp34, putative [Ricinus communis] gi|223533753|gb|EEF35485.1| peroxisomal membrane protein pmp34, putative [Ricinus communis] Length = 338 Score = 56.6 bits (135), Expect(2) = 2e-12 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -1 Query: 100 GAVEQMYQVIQQEGWGRLYGGLTPSLVGTACSQ 2 G +EQM QV++ EGW RLYGGLTPSLVGTA SQ Sbjct: 46 GTIEQMCQVVKNEGWERLYGGLTPSLVGTAASQ 78 Score = 40.0 bits (92), Expect(2) = 2e-12 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 251 TYPLQTVNTRQQTDRDP 201 TYPLQTVNTRQQTDRDP Sbjct: 22 TYPLQTVNTRQQTDRDP 38 >ref|XP_002279488.2| PREDICTED: mitochondrial substrate carrier family protein Q [Vitis vinifera] Length = 342 Score = 57.8 bits (138), Expect(2) = 3e-12 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -1 Query: 100 GAVEQMYQVIQQEGWGRLYGGLTPSLVGTACSQ 2 G + QMYQV++ EGW RLYGGLTPSLVGTA SQ Sbjct: 46 GTIGQMYQVVKHEGWDRLYGGLTPSLVGTAASQ 78 Score = 38.5 bits (88), Expect(2) = 3e-12 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -3 Query: 251 TYPLQTVNTRQQTDRDP 201 TYPLQTVNTRQQT+RDP Sbjct: 22 TYPLQTVNTRQQTERDP 38 >emb|CBI31533.3| unnamed protein product [Vitis vinifera] Length = 337 Score = 57.8 bits (138), Expect(2) = 3e-12 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -1 Query: 100 GAVEQMYQVIQQEGWGRLYGGLTPSLVGTACSQ 2 G + QMYQV++ EGW RLYGGLTPSLVGTA SQ Sbjct: 46 GTIGQMYQVVKHEGWDRLYGGLTPSLVGTAASQ 78 Score = 38.5 bits (88), Expect(2) = 3e-12 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -3 Query: 251 TYPLQTVNTRQQTDRDP 201 TYPLQTVNTRQQT+RDP Sbjct: 22 TYPLQTVNTRQQTERDP 38 >ref|XP_003616573.1| Peroxisomal membrane protein [Medicago truncatula] gi|355517908|gb|AES99531.1| Peroxisomal membrane protein [Medicago truncatula] Length = 336 Score = 53.5 bits (127), Expect(2) = 2e-11 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = -1 Query: 100 GAVEQMYQVIQQEGWGRLYGGLTPSLVGTACSQ 2 G +QM QV++QEGW RLYGGL PSLVGTA SQ Sbjct: 46 GTFQQMCQVVKQEGWERLYGGLAPSLVGTATSQ 78 Score = 40.0 bits (92), Expect(2) = 2e-11 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 251 TYPLQTVNTRQQTDRDP 201 TYPLQTVNTRQQTDRDP Sbjct: 22 TYPLQTVNTRQQTDRDP 38 >ref|XP_002315175.1| predicted protein [Populus trichocarpa] gi|222864215|gb|EEF01346.1| predicted protein [Populus trichocarpa] Length = 340 Score = 57.4 bits (137), Expect(2) = 7e-11 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -1 Query: 100 GAVEQMYQVIQQEGWGRLYGGLTPSLVGTACSQ 2 G +EQM QV++ EGWGRLY GL PS+VGTACSQ Sbjct: 46 GTLEQMCQVVKNEGWGRLYSGLAPSIVGTACSQ 78 Score = 34.3 bits (77), Expect(2) = 7e-11 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = -3 Query: 251 TYPLQTVNTRQQTDRD 204 TYPLQ+VNTRQQT+RD Sbjct: 22 TYPLQSVNTRQQTERD 37