BLASTX nr result
ID: Atractylodes22_contig00024076
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00024076 (241 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAG40879.1|AF321497_1 phosphoribosylaminoimidazolecarboxamide... 141 6e-32 ref|NP_001234704.1| putative inosine monophosphate cyclohydrolas... 140 1e-31 ref|XP_003598438.1| Bifunctional purine biosynthesis protein pur... 132 3e-29 ref|XP_004145129.1| PREDICTED: bifunctional purine biosynthesis ... 132 4e-29 ref|XP_003617820.1| Bifunctional purine biosynthesis protein Pur... 132 4e-29 >gb|AAG40879.1|AF321497_1 phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase [Nicotiana tabacum] Length = 612 Score = 141 bits (355), Expect = 6e-32 Identities = 65/79 (82%), Positives = 74/79 (93%) Frame = +3 Query: 3 DQSHHMEALDKHNISTFELVVVNLYPFYAKVSSSNGVTFDDGIENIDIGGPTMIRAAAKN 182 DQ HHMEAL+KH I TF++VVVNLYPFYAKVSSS+G++F+DGIENIDIGGP MIRAAAKN Sbjct: 165 DQEHHMEALEKHEIGTFDVVVVNLYPFYAKVSSSSGISFEDGIENIDIGGPAMIRAAAKN 224 Query: 183 HKDVLVVVDSQDYPVLLEF 239 H+DVLVVVDS+DYP LLEF Sbjct: 225 HRDVLVVVDSEDYPALLEF 243 >ref|NP_001234704.1| putative inosine monophosphate cyclohydrolase [Solanum lycopersicum] gi|260528216|gb|ACX44804.1| putative inosine monophosphate cyclohydrolase [Solanum lycopersicum] Length = 600 Score = 140 bits (352), Expect = 1e-31 Identities = 65/79 (82%), Positives = 74/79 (93%) Frame = +3 Query: 3 DQSHHMEALDKHNISTFELVVVNLYPFYAKVSSSNGVTFDDGIENIDIGGPTMIRAAAKN 182 DQ HHMEAL+KH I TF++VVVNLYPFYAKVSSS+G++F+DGIENIDIGGP MIRAAAKN Sbjct: 153 DQEHHMEALEKHEIGTFDVVVVNLYPFYAKVSSSSGISFEDGIENIDIGGPAMIRAAAKN 212 Query: 183 HKDVLVVVDSQDYPVLLEF 239 H+DVLVVVDS+DYP LLEF Sbjct: 213 HRDVLVVVDSEDYPDLLEF 231 >ref|XP_003598438.1| Bifunctional purine biosynthesis protein purH [Medicago truncatula] gi|355487486|gb|AES68689.1| Bifunctional purine biosynthesis protein purH [Medicago truncatula] Length = 594 Score = 132 bits (332), Expect = 3e-29 Identities = 61/79 (77%), Positives = 69/79 (87%) Frame = +3 Query: 3 DQSHHMEALDKHNISTFELVVVNLYPFYAKVSSSNGVTFDDGIENIDIGGPTMIRAAAKN 182 DQ HHMEAL+ H I TF++V+VNLYPFY KV+S+ G+ F DGIENIDIGGP MIRAAAKN Sbjct: 148 DQKHHMEALNTHGIGTFDVVIVNLYPFYDKVTSAGGIEFKDGIENIDIGGPAMIRAAAKN 207 Query: 183 HKDVLVVVDSQDYPVLLEF 239 HKDVLVVVDS+DYP LLEF Sbjct: 208 HKDVLVVVDSEDYPALLEF 226 >ref|XP_004145129.1| PREDICTED: bifunctional purine biosynthesis protein PurH-like [Cucumis sativus] gi|449472285|ref|XP_004153547.1| PREDICTED: bifunctional purine biosynthesis protein PurH-like [Cucumis sativus] gi|449503357|ref|XP_004161962.1| PREDICTED: bifunctional purine biosynthesis protein PurH-like [Cucumis sativus] Length = 604 Score = 132 bits (331), Expect = 4e-29 Identities = 61/79 (77%), Positives = 69/79 (87%) Frame = +3 Query: 3 DQSHHMEALDKHNISTFELVVVNLYPFYAKVSSSNGVTFDDGIENIDIGGPTMIRAAAKN 182 DQ HHM+AL KH I TF++VVVNLYPFY KV+SS + F+DGIENIDIGGP MIRAAAKN Sbjct: 157 DQGHHMDALKKHGIGTFDVVVVNLYPFYEKVTSSQEINFEDGIENIDIGGPAMIRAAAKN 216 Query: 183 HKDVLVVVDSQDYPVLLEF 239 HKDVLVVVD++DYP LLEF Sbjct: 217 HKDVLVVVDTEDYPALLEF 235 >ref|XP_003617820.1| Bifunctional purine biosynthesis protein PurH [Medicago truncatula] gi|355519155|gb|AET00779.1| Bifunctional purine biosynthesis protein PurH [Medicago truncatula] Length = 665 Score = 132 bits (331), Expect = 4e-29 Identities = 61/79 (77%), Positives = 69/79 (87%) Frame = +3 Query: 3 DQSHHMEALDKHNISTFELVVVNLYPFYAKVSSSNGVTFDDGIENIDIGGPTMIRAAAKN 182 DQ HH+EAL H I TF++VVVNLYPFY KV+S+ G+ F+DGIENIDIGGP MIRAAAKN Sbjct: 217 DQKHHIEALSTHGIGTFDVVVVNLYPFYDKVTSTGGIEFEDGIENIDIGGPAMIRAAAKN 276 Query: 183 HKDVLVVVDSQDYPVLLEF 239 HKDVLVVVDS+DYP LLEF Sbjct: 277 HKDVLVVVDSEDYPALLEF 295