BLASTX nr result
ID: Atractylodes22_contig00023393
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00023393 (312 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281414.2| PREDICTED: methyl-CpG-binding domain-contain... 58 9e-07 emb|CAN67324.1| hypothetical protein VITISV_012829 [Vitis vinifera] 58 9e-07 >ref|XP_002281414.2| PREDICTED: methyl-CpG-binding domain-containing protein 7-like [Vitis vinifera] gi|297746130|emb|CBI16186.3| unnamed protein product [Vitis vinifera] Length = 212 Score = 57.8 bits (138), Expect = 9e-07 Identities = 20/43 (46%), Positives = 30/43 (69%) Frame = +3 Query: 84 PPSKINWIIASSGGETWNAFVGDSLVPDSLKQEWGKRFMLAIN 212 PP K+NW++ GG+ W+ ++ S VP+S+KQ W K FML +N Sbjct: 167 PPKKVNWVLTGPGGDVWSPYINASAVPESIKQTWAKIFMLHVN 209 >emb|CAN67324.1| hypothetical protein VITISV_012829 [Vitis vinifera] Length = 212 Score = 57.8 bits (138), Expect = 9e-07 Identities = 20/43 (46%), Positives = 30/43 (69%) Frame = +3 Query: 84 PPSKINWIIASSGGETWNAFVGDSLVPDSLKQEWGKRFMLAIN 212 PP K+NW++ GG+ W+ ++ S VP+S+KQ W K FML +N Sbjct: 167 PPKKVNWVLTGPGGDVWSPYINASAVPESIKQTWAKIFMLHVN 209