BLASTX nr result
ID: Atractylodes22_contig00023269
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00023269 (200 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003635004.1| PREDICTED: putative F-box/LRR-repeat protein... 55 5e-06 emb|CBI23315.3| unnamed protein product [Vitis vinifera] 55 5e-06 emb|CAN78503.1| hypothetical protein VITISV_023071 [Vitis vinifera] 55 5e-06 >ref|XP_003635004.1| PREDICTED: putative F-box/LRR-repeat protein At5g02930-like [Vitis vinifera] Length = 610 Score = 55.5 bits (132), Expect = 5e-06 Identities = 30/66 (45%), Positives = 40/66 (60%) Frame = -3 Query: 198 IENILSGSPLLETLVLDDCYGYRRLDISSKSVKNLVFRGYLDLEEESHDLADIIEINAPN 19 IE ILSG P LE+L L C+G L+I+S S+K LV Y D H +++I+APN Sbjct: 242 IEEILSGCPALESLELHHCFGINSLNITSASLKKLVINRYWDSSHSHH--RSVLKISAPN 299 Query: 18 ILSLKI 1 + SL I Sbjct: 300 VQSLGI 305 >emb|CBI23315.3| unnamed protein product [Vitis vinifera] Length = 340 Score = 55.5 bits (132), Expect = 5e-06 Identities = 30/66 (45%), Positives = 40/66 (60%) Frame = -3 Query: 198 IENILSGSPLLETLVLDDCYGYRRLDISSKSVKNLVFRGYLDLEEESHDLADIIEINAPN 19 IE ILSG P LE+L L C+G L+I+S S+K LV Y D H +++I+APN Sbjct: 150 IEEILSGCPALESLELHHCFGINSLNITSASLKKLVINRYWDSSHSHH--RSVLKISAPN 207 Query: 18 ILSLKI 1 + SL I Sbjct: 208 VQSLGI 213 >emb|CAN78503.1| hypothetical protein VITISV_023071 [Vitis vinifera] Length = 891 Score = 55.5 bits (132), Expect = 5e-06 Identities = 30/66 (45%), Positives = 40/66 (60%) Frame = -3 Query: 198 IENILSGSPLLETLVLDDCYGYRRLDISSKSVKNLVFRGYLDLEEESHDLADIIEINAPN 19 IE ILSG P LE+L L C+G L+I+S S+K LV Y D H +++I+APN Sbjct: 242 IEEILSGCPALESLELHHCFGINSLNITSASLKKLVINRYWDSSHSHH--RSVLKISAPN 299 Query: 18 ILSLKI 1 + SL I Sbjct: 300 VQSLGI 305