BLASTX nr result
ID: Atractylodes22_contig00023201
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00023201 (227 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI27138.3| unnamed protein product [Vitis vinifera] 58 7e-07 ref|XP_002527141.1| protein binding protein, putative [Ricinus c... 58 9e-07 ref|XP_002872036.1| zinc finger family protein [Arabidopsis lyra... 57 2e-06 ref|NP_197702.1| C3HC4-type RING finger domain-containing protei... 57 2e-06 >emb|CBI27138.3| unnamed protein product [Vitis vinifera] Length = 3960 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = -1 Query: 125 KLVALGGTNLTERFRDQFSPMFVGQKVPW-STDSTVIRMPIS 3 K+ +L GTNLTERF DQF+PM +GQ +PW S+D TV+RMP+S Sbjct: 2290 KVFSLIGTNLTERFCDQFNPMLIGQNMPWSSSDCTVMRMPLS 2331 >ref|XP_002527141.1| protein binding protein, putative [Ricinus communis] gi|223533501|gb|EEF35243.1| protein binding protein, putative [Ricinus communis] Length = 4704 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/42 (64%), Positives = 34/42 (80%), Gaps = 1/42 (2%) Frame = -1 Query: 125 KLVALGGTNLTERFRDQFSPMFVGQKVPW-STDSTVIRMPIS 3 K+ +L GTNLTERF DQF+PM +G+K W S DST+IRMP+S Sbjct: 2938 KMFSLIGTNLTERFSDQFNPMLIGEKKSWLSQDSTIIRMPLS 2979 >ref|XP_002872036.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297317873|gb|EFH48295.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] Length = 4711 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/42 (64%), Positives = 33/42 (78%), Gaps = 1/42 (2%) Frame = -1 Query: 125 KLVALGGTNLTERFRDQFSPMFVGQKVPWS-TDSTVIRMPIS 3 K+ +L GTNL ERF DQF+PM +GQ WS TDST+IRMP+S Sbjct: 2915 KMFSLIGTNLVERFSDQFNPMLIGQDKAWSLTDSTIIRMPLS 2956 >ref|NP_197702.1| C3HC4-type RING finger domain-containing protein [Arabidopsis thaliana] gi|9759369|dbj|BAB09828.1| unnamed protein product [Arabidopsis thaliana] gi|332005740|gb|AED93123.1| C3HC4-type RING finger domain-containing protein [Arabidopsis thaliana] Length = 4706 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/42 (64%), Positives = 33/42 (78%), Gaps = 1/42 (2%) Frame = -1 Query: 125 KLVALGGTNLTERFRDQFSPMFVGQKVPWS-TDSTVIRMPIS 3 K+ +L GTNL ERF DQF+PM +GQ WS TDST+IRMP+S Sbjct: 2915 KMFSLIGTNLVERFSDQFNPMLIGQDKAWSLTDSTIIRMPLS 2956