BLASTX nr result
ID: Atractylodes22_contig00023194
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00023194 (352 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAC39472.1| vacuolar protein sorting homolog [Arabidopsis tha... 77 1e-12 ref|NP_565150.1| vacuolar protein sorting-associated protein 45-... 77 1e-12 ref|XP_002887671.1| hypothetical protein ARALYDRAFT_476877 [Arab... 77 1e-12 ref|XP_002526156.1| vacuolar protein sorting-associated, putativ... 75 6e-12 ref|XP_002263592.1| PREDICTED: vacuolar protein sorting-associat... 75 7e-12 >gb|AAC39472.1| vacuolar protein sorting homolog [Arabidopsis thaliana] Length = 569 Score = 77.4 bits (189), Expect = 1e-12 Identities = 43/59 (72%), Positives = 46/59 (77%) Frame = -3 Query: 179 MVLVSSVRDYINRMLQDISGMKVLILDXXXXXXXXXXXXXSELLQKEVFLVEMVDSISM 3 MVLV+SVRDYINRMLQDISGMKVLILD SELLQKEVFLVEM+DSIS+ Sbjct: 1 MVLVTSVRDYINRMLQDISGMKVLILDSETVSNVSIVYSQSELLQKEVFLVEMIDSISV 59 >ref|NP_565150.1| vacuolar protein sorting-associated protein 45-like protein [Arabidopsis thaliana] gi|28201912|sp|O49048.2|VPS45_ARATH RecName: Full=Vacuolar protein sorting-associated protein 45 homolog; Short=AtVPS45 gi|3540194|gb|AAC34344.1| AtVPS45p [Arabidopsis thaliana] gi|15215684|gb|AAK91388.1| At1g77140/T14N5_2 [Arabidopsis thaliana] gi|20855922|gb|AAM26638.1| At1g77140/T14N5_2 [Arabidopsis thaliana] gi|332197819|gb|AEE35940.1| vacuolar protein sorting-associated protein 45-like protein [Arabidopsis thaliana] Length = 569 Score = 77.4 bits (189), Expect = 1e-12 Identities = 43/59 (72%), Positives = 46/59 (77%) Frame = -3 Query: 179 MVLVSSVRDYINRMLQDISGMKVLILDXXXXXXXXXXXXXSELLQKEVFLVEMVDSISM 3 MVLV+SVRDYINRMLQDISGMKVLILD SELLQKEVFLVEM+DSIS+ Sbjct: 1 MVLVTSVRDYINRMLQDISGMKVLILDSETVSNVSIVYSQSELLQKEVFLVEMIDSISV 59 >ref|XP_002887671.1| hypothetical protein ARALYDRAFT_476877 [Arabidopsis lyrata subsp. lyrata] gi|297333512|gb|EFH63930.1| hypothetical protein ARALYDRAFT_476877 [Arabidopsis lyrata subsp. lyrata] Length = 569 Score = 77.4 bits (189), Expect = 1e-12 Identities = 43/59 (72%), Positives = 46/59 (77%) Frame = -3 Query: 179 MVLVSSVRDYINRMLQDISGMKVLILDXXXXXXXXXXXXXSELLQKEVFLVEMVDSISM 3 MVLV+SVRDYINRMLQDISGMKVLILD SELLQKEVFLVEM+DSIS+ Sbjct: 1 MVLVTSVRDYINRMLQDISGMKVLILDSETVSNVSIVYSQSELLQKEVFLVEMIDSISV 59 >ref|XP_002526156.1| vacuolar protein sorting-associated, putative [Ricinus communis] gi|223534533|gb|EEF36232.1| vacuolar protein sorting-associated, putative [Ricinus communis] Length = 537 Score = 75.1 bits (183), Expect = 6e-12 Identities = 42/58 (72%), Positives = 45/58 (77%) Frame = -3 Query: 179 MVLVSSVRDYINRMLQDISGMKVLILDXXXXXXXXXXXXXSELLQKEVFLVEMVDSIS 6 MVLV++VRDYINRMLQDISGMKVLILD SELLQKEVFLVE+VDSIS Sbjct: 1 MVLVTAVRDYINRMLQDISGMKVLILDSQTVSIVSVVYSQSELLQKEVFLVELVDSIS 58 >ref|XP_002263592.1| PREDICTED: vacuolar protein sorting-associated protein 45 homolog [Vitis vinifera] gi|302142769|emb|CBI19972.3| unnamed protein product [Vitis vinifera] Length = 568 Score = 74.7 bits (182), Expect = 7e-12 Identities = 41/59 (69%), Positives = 46/59 (77%) Frame = -3 Query: 179 MVLVSSVRDYINRMLQDISGMKVLILDXXXXXXXXXXXXXSELLQKEVFLVEMVDSISM 3 MVL+S+VRDY++RMLQDISGMKVLILD SELLQKEVFLVE+VDSISM Sbjct: 1 MVLISAVRDYMSRMLQDISGMKVLILDSQTVSIVSVVYSQSELLQKEVFLVELVDSISM 59