BLASTX nr result
ID: Atractylodes22_contig00023158
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00023158 (434 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003622970.1| Pantothenate synthetase [Medicago truncatula... 62 2e-10 ref|XP_003618219.1| hypothetical protein MTR_6g006160 [Medicago ... 62 6e-08 >ref|XP_003622970.1| Pantothenate synthetase [Medicago truncatula] gi|355497985|gb|AES79188.1| Pantothenate synthetase [Medicago truncatula] Length = 551 Score = 62.4 bits (150), Expect(2) = 2e-10 Identities = 29/61 (47%), Positives = 39/61 (63%) Frame = +2 Query: 23 IGNGDSTSFWKDK*LGDFELCSKFPRLFRLENEADVKVKDRISHREGEWFWSWNWNWHRE 202 +GNG +TSFWKD+ +GD LC FPRLF + ++ +VKV+D +EG WN W R Sbjct: 129 VGNGSNTSFWKDRWIGDLLLCVAFPRLFVISSQKEVKVRDVSVMQEG--VRRWNLVWRRH 186 Query: 203 P 205 P Sbjct: 187 P 187 Score = 27.7 bits (60), Expect(2) = 2e-10 Identities = 15/55 (27%), Positives = 24/55 (43%), Gaps = 6/55 (10%) Frame = +1 Query: 280 DGWSWALAKNRDFSVKDLRSLIDEKLLQSPG------RRMETSWCNSVPRKVCVF 426 D W+W + FSV+ +++ LL G R + + W + P KV F Sbjct: 212 DDWAWTPEEGGKFSVRSSYRVLESLLLLEEGLSALEERVLASLWKSPAPSKVVAF 266 >ref|XP_003618219.1| hypothetical protein MTR_6g006160 [Medicago truncatula] gi|355493234|gb|AES74437.1| hypothetical protein MTR_6g006160 [Medicago truncatula] Length = 325 Score = 61.6 bits (148), Expect = 6e-08 Identities = 31/61 (50%), Positives = 36/61 (59%) Frame = +2 Query: 23 IGNGDSTSFWKDK*LGDFELCSKFPRLFRLENEADVKVKDRISHREGEWFWSWNWNWHRE 202 IGNG +TSFWKDK +GD L FPRLF L N+ + KV D + R G WN W R Sbjct: 65 IGNGRNTSFWKDKWVGDAPLFRTFPRLFSLSNQKEAKVGDVVEIRGGGCV--WNTTWRRN 122 Query: 203 P 205 P Sbjct: 123 P 123