BLASTX nr result
ID: Atractylodes22_contig00023033
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00023033 (357 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003630244.1| hypothetical protein MTR_8g093410 [Medicago ... 63 3e-08 ref|XP_003626920.1| GRF zinc finger containing protein [Medicago... 62 5e-08 ref|XP_003612076.1| GRF zinc finger containing protein [Medicago... 60 2e-07 ref|XP_003593148.1| GRF zinc finger containing protein [Medicago... 60 2e-07 ref|XP_003629442.1| GRF zinc finger containing protein [Medicago... 59 4e-07 >ref|XP_003630244.1| hypothetical protein MTR_8g093410 [Medicago truncatula] gi|355524266|gb|AET04720.1| hypothetical protein MTR_8g093410 [Medicago truncatula] Length = 109 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/55 (50%), Positives = 35/55 (63%) Frame = -3 Query: 250 SSFLVCLCGDKMKLSTSWTKSNPGRRFLGCPNYIYGQKCQSFEFVDDELPNQYYK 86 SSFLVC CG + L T+WT NPGRRF GC Y +KC F + D E+P++ K Sbjct: 13 SSFLVCYCGVESPLVTAWTDENPGRRFHGCGKYWQRRKCSFFRWFDPEVPDRQKK 67 >ref|XP_003626920.1| GRF zinc finger containing protein [Medicago truncatula] gi|355520942|gb|AET01396.1| GRF zinc finger containing protein [Medicago truncatula] Length = 116 Score = 62.0 bits (149), Expect = 5e-08 Identities = 27/52 (51%), Positives = 32/52 (61%) Frame = -3 Query: 241 LVCLCGDKMKLSTSWTKSNPGRRFLGCPNYIYGQKCQSFEFVDDELPNQYYK 86 LVC CG L TSWT NPGRRF GC Y G+KC F + D E+P++ K Sbjct: 20 LVCYCGVDSPLVTSWTDENPGRRFHGCGRYFVGRKCNFFRWYDPEVPDRQKK 71 >ref|XP_003612076.1| GRF zinc finger containing protein [Medicago truncatula] gi|355513411|gb|AES95034.1| GRF zinc finger containing protein [Medicago truncatula] Length = 116 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/56 (48%), Positives = 33/56 (58%) Frame = -3 Query: 253 ASSFLVCLCGDKMKLSTSWTKSNPGRRFLGCPNYIYGQKCQSFEFVDDELPNQYYK 86 A S LVC CG + L T+WT NPGRRF GC Y +KC F + D E+P + K Sbjct: 17 AKSRLVCYCGVESPLVTAWTDENPGRRFHGCGKYFQRRKCSFFRWFDPEVPERQKK 72 >ref|XP_003593148.1| GRF zinc finger containing protein [Medicago truncatula] gi|355482196|gb|AES63399.1| GRF zinc finger containing protein [Medicago truncatula] Length = 116 Score = 59.7 bits (143), Expect = 2e-07 Identities = 27/56 (48%), Positives = 33/56 (58%) Frame = -3 Query: 253 ASSFLVCLCGDKMKLSTSWTKSNPGRRFLGCPNYIYGQKCQSFEFVDDELPNQYYK 86 A S LVC CG + L T+WT NPGRRF GC Y +KC F + D E+P + K Sbjct: 17 AKSRLVCYCGVESPLVTAWTDENPGRRFHGCGKYFQRRKCSFFRWFDPEVPERRKK 72 >ref|XP_003629442.1| GRF zinc finger containing protein [Medicago truncatula] gi|355523464|gb|AET03918.1| GRF zinc finger containing protein [Medicago truncatula] Length = 75 Score = 58.9 bits (141), Expect = 4e-07 Identities = 25/52 (48%), Positives = 32/52 (61%) Frame = -3 Query: 241 LVCLCGDKMKLSTSWTKSNPGRRFLGCPNYIYGQKCQSFEFVDDELPNQYYK 86 LVC CG L T+WT NPGRRF GC Y+ +KC F + D E+P++ K Sbjct: 21 LVCYCGVDSPLVTAWTDENPGRRFHGCGKYLQRRKCSFFRWFDPEVPDRQIK 72