BLASTX nr result
ID: Atractylodes22_contig00022831
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00022831 (524 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACC60981.1| beta-galactosidase 1 precursor [Petunia x hybrida] 78 9e-13 ref|NP_001234303.1| beta-galactosidase precursor [Solanum lycope... 74 1e-11 gb|ADO34788.1| beta-galactosidase STBG3 [Solanum lycopersicum] 74 1e-11 emb|CAA07236.2| beta-galactosidase precursor [Cicer arietinum] 69 5e-10 ref|XP_003531618.1| PREDICTED: beta-galactosidase 1-like [Glycin... 67 2e-09 >gb|ACC60981.1| beta-galactosidase 1 precursor [Petunia x hybrida] Length = 842 Score = 77.8 bits (190), Expect = 9e-13 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -3 Query: 522 YCIGQQSCTVPVTPEIFGGDPCPKVMKKLSVEAICS 415 YCIGQ+SCTVPVTPEIFGGDPCP VMKKLSVEA+CS Sbjct: 807 YCIGQESCTVPVTPEIFGGDPCPSVMKKLSVEAVCS 842 >ref|NP_001234303.1| beta-galactosidase precursor [Solanum lycopersicum] gi|7939619|gb|AAF70822.1|AF154421_1 beta-galactosidase [Solanum lycopersicum] gi|4138137|emb|CAA10173.1| ss-galactosidase [Solanum lycopersicum] Length = 838 Score = 73.9 bits (180), Expect = 1e-11 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -3 Query: 522 YCIGQQSCTVPVTPEIFGGDPCPKVMKKLSVEAICS 415 YCIGQ SC+VPVTPEIFGGDPCP VMKKLSVE ICS Sbjct: 803 YCIGQNSCSVPVTPEIFGGDPCPHVMKKLSVEVICS 838 >gb|ADO34788.1| beta-galactosidase STBG3 [Solanum lycopersicum] Length = 838 Score = 73.9 bits (180), Expect = 1e-11 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -3 Query: 522 YCIGQQSCTVPVTPEIFGGDPCPKVMKKLSVEAICS 415 YCIGQ SC+VPVTPEIFGGDPCP VMKKLSVE ICS Sbjct: 803 YCIGQNSCSVPVTPEIFGGDPCPHVMKKLSVEVICS 838 >emb|CAA07236.2| beta-galactosidase precursor [Cicer arietinum] Length = 839 Score = 68.6 bits (166), Expect = 5e-10 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -3 Query: 519 CIGQQSCTVPVTPEIFGGDPCPKVMKKLSVEAICS 415 C+GQ SCTV V+PEIFGGDPCP VMKKLSVEAIC+ Sbjct: 805 CVGQSSCTVTVSPEIFGGDPCPNVMKKLSVEAICT 839 >ref|XP_003531618.1| PREDICTED: beta-galactosidase 1-like [Glycine max] Length = 843 Score = 66.6 bits (161), Expect = 2e-09 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -3 Query: 519 CIGQQSCTVPVTPEIFGGDPCPKVMKKLSVEAICS 415 C+GQ CTV V+PEIFGGDPCP+VMKKLSVEAIC+ Sbjct: 809 CVGQSWCTVTVSPEIFGGDPCPRVMKKLSVEAICT 843