BLASTX nr result
ID: Atractylodes22_contig00022805
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00022805 (288 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_564806.1| 3,5-epimerase/4-reductase [Arabidopsis thaliana... 58 7e-07 ref|XP_002887985.1| hypothetical protein ARALYDRAFT_893174 [Arab... 58 7e-07 gb|AAK62450.1|AF387005_1 Unknown protein [Arabidopsis thaliana] 58 7e-07 gb|AAM65668.1| unknown [Arabidopsis thaliana] 58 7e-07 ref|XP_002440852.1| hypothetical protein SORBIDRAFT_09g008220 [S... 56 3e-06 >ref|NP_564806.1| 3,5-epimerase/4-reductase [Arabidopsis thaliana] gi|8493590|gb|AAF75813.1|AC011000_16 Contains weak similarity to 5-epimerase from Saccharopolyspora erythraea gb|L37354. ESTs gb|T41773, gb|R29767, gb|T88368, gb|F13963 come from this gene [Arabidopsis thaliana] gi|12083298|gb|AAG48808.1|AF332445_1 unknown protein [Arabidopsis thaliana] gi|41080591|gb|AAR99502.1| 3,5-epimerase/4-reductase [Arabidopsis thaliana] gi|332195914|gb|AEE34035.1| 3,5-epimerase/4-reductase [Arabidopsis thaliana] Length = 301 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 283 TKLKTEFPELLSIKESLVKFVFEPNRKTPVAA 188 TKLKTEFPEL+SIKESL+KFVFEPN+KT V A Sbjct: 270 TKLKTEFPELMSIKESLIKFVFEPNKKTEVKA 301 >ref|XP_002887985.1| hypothetical protein ARALYDRAFT_893174 [Arabidopsis lyrata subsp. lyrata] gi|297333826|gb|EFH64244.1| hypothetical protein ARALYDRAFT_893174 [Arabidopsis lyrata subsp. lyrata] Length = 300 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 283 TKLKTEFPELLSIKESLVKFVFEPNRKTPVAA 188 TKLKTEFPEL+SIKESL+KFVFEPN+KT V A Sbjct: 269 TKLKTEFPELMSIKESLIKFVFEPNKKTEVKA 300 >gb|AAK62450.1|AF387005_1 Unknown protein [Arabidopsis thaliana] Length = 301 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 283 TKLKTEFPELLSIKESLVKFVFEPNRKTPVAA 188 TKLKTEFPEL+SIKESL+KFVFEPN+KT V A Sbjct: 270 TKLKTEFPELMSIKESLIKFVFEPNKKTEVKA 301 >gb|AAM65668.1| unknown [Arabidopsis thaliana] Length = 300 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 283 TKLKTEFPELLSIKESLVKFVFEPNRKTPVAA 188 TKLKTEFPEL+SIKESL+KFVFEPN+KT V A Sbjct: 269 TKLKTEFPELMSIKESLIKFVFEPNKKTEVKA 300 >ref|XP_002440852.1| hypothetical protein SORBIDRAFT_09g008220 [Sorghum bicolor] gi|241946137|gb|EES19282.1| hypothetical protein SORBIDRAFT_09g008220 [Sorghum bicolor] Length = 666 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 283 TKLKTEFPELLSIKESLVKFVFEPNRKTPV 194 TKLK EFPELLSIK+SL+KFVFEPNRK P+ Sbjct: 636 TKLKKEFPELLSIKDSLIKFVFEPNRKVPI 665