BLASTX nr result
ID: Atractylodes22_contig00022754
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00022754 (845 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273322.1| PREDICTED: nucleolar protein 14-like [Vitis ... 57 1e-07 emb|CBI27323.3| unnamed protein product [Vitis vinifera] 57 1e-07 emb|CAN71711.1| hypothetical protein VITISV_013458 [Vitis vinifera] 57 1e-07 ref|XP_002316013.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 ref|XP_004165503.1| PREDICTED: nucleolar protein 14-like [Cucumi... 55 1e-06 >ref|XP_002273322.1| PREDICTED: nucleolar protein 14-like [Vitis vinifera] Length = 973 Score = 57.0 bits (136), Expect(2) = 1e-07 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -3 Query: 234 RDYDPDRQRAEDRKLKKLVKREVNGAYRELPKDTSWLMQ 118 RDYDPDR+RAE RKLKKL+K+E GA REL KD +L + Sbjct: 891 RDYDPDRERAEQRKLKKLIKQEAKGAARELRKDNYFLFE 929 Score = 25.0 bits (53), Expect(2) = 1e-07 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -2 Query: 142 EGYFLADAKVRDKAPLEEE 86 + YFL + K RDKA EEE Sbjct: 923 DNYFLFEVKKRDKAMQEEE 941 >emb|CBI27323.3| unnamed protein product [Vitis vinifera] Length = 899 Score = 57.0 bits (136), Expect(2) = 1e-07 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -3 Query: 234 RDYDPDRQRAEDRKLKKLVKREVNGAYRELPKDTSWLMQ 118 RDYDPDR+RAE RKLKKL+K+E GA REL KD +L + Sbjct: 817 RDYDPDRERAEQRKLKKLIKQEAKGAARELRKDNYFLFE 855 Score = 25.0 bits (53), Expect(2) = 1e-07 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -2 Query: 142 EGYFLADAKVRDKAPLEEE 86 + YFL + K RDKA EEE Sbjct: 849 DNYFLFEVKKRDKAMQEEE 867 >emb|CAN71711.1| hypothetical protein VITISV_013458 [Vitis vinifera] Length = 815 Score = 57.0 bits (136), Expect(2) = 1e-07 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -3 Query: 234 RDYDPDRQRAEDRKLKKLVKREVNGAYRELPKDTSWLMQ 118 RDYDPDR+RAE RKLKKL+K+E GA REL KD +L + Sbjct: 733 RDYDPDRERAEQRKLKKLIKQEAKGAARELRKDNYFLFE 771 Score = 25.0 bits (53), Expect(2) = 1e-07 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -2 Query: 142 EGYFLADAKVRDKAPLEEE 86 + YFL + K RDKA EEE Sbjct: 765 DNYFLFEVKKRDKAMQEEE 783 >ref|XP_002316013.1| predicted protein [Populus trichocarpa] gi|222865053|gb|EEF02184.1| predicted protein [Populus trichocarpa] Length = 251 Score = 60.5 bits (145), Expect(2) = 2e-07 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = -3 Query: 234 RDYDPDRQRAEDRKLKKLVKREVNGAYRELPKDTSWLMQ 118 RDYDPDR+RAE RKLKKLVKRE GA REL KD S+L + Sbjct: 167 RDYDPDRERAERRKLKKLVKREAKGAARELRKDNSFLFE 205 Score = 21.2 bits (43), Expect(2) = 2e-07 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -2 Query: 133 FLADAKVRDKAPLEEE 86 FL + K +DKA LE+E Sbjct: 202 FLFEVKEKDKALLEDE 217 >ref|XP_004165503.1| PREDICTED: nucleolar protein 14-like [Cucumis sativus] Length = 914 Score = 54.7 bits (130), Expect(2) = 1e-06 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = -3 Query: 234 RDYDPDRQRAEDRKLKKLVKREVNGAYRELPKDTSWLMQ 118 RDYDPDR+RAE RK++KL+KRE GA REL KD +L + Sbjct: 832 RDYDPDRERAERRKMQKLLKRETKGAARELRKDNHFLSE 870 Score = 24.3 bits (51), Expect(2) = 1e-06 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = -2 Query: 142 EGYFLADAKVRDKAPLEEE 86 + +FL++ K RDKA +EE Sbjct: 864 DNHFLSEVKARDKAKQDEE 882