BLASTX nr result
ID: Atractylodes22_contig00022608
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00022608 (251 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002302931.1| predicted protein [Populus trichocarpa] gi|2... 65 6e-09 ref|XP_002265397.2| PREDICTED: pentatricopeptide repeat-containi... 62 4e-08 emb|CBI15328.3| unnamed protein product [Vitis vinifera] 62 4e-08 ref|XP_002514631.1| pentatricopeptide repeat-containing protein,... 61 1e-07 >ref|XP_002302931.1| predicted protein [Populus trichocarpa] gi|222844657|gb|EEE82204.1| predicted protein [Populus trichocarpa] Length = 516 Score = 65.1 bits (157), Expect = 6e-09 Identities = 35/52 (67%), Positives = 38/52 (73%), Gaps = 1/52 (1%) Frame = -2 Query: 250 YKLDPRFMKKPTAVK-EKKRETLPEKMAXXXXXXXXXXLSFVKKPKKAQRRA 98 Y++DP+FMKKP AVK EKKRETLPEKMA LSFVKKPKK RRA Sbjct: 464 YRVDPKFMKKPKAVKKEKKRETLPEKMARKRRRLKQIRLSFVKKPKKGMRRA 515 >ref|XP_002265397.2| PREDICTED: pentatricopeptide repeat-containing protein At5g60960, mitochondrial-like [Vitis vinifera] Length = 516 Score = 62.4 bits (150), Expect = 4e-08 Identities = 34/50 (68%), Positives = 37/50 (74%), Gaps = 1/50 (2%) Frame = -2 Query: 250 YKLDPRFMKKPT-AVKEKKRETLPEKMAXXXXXXXXXXLSFVKKPKKAQR 104 YKLDPRF+KKPT A KEKKRETLPEKMA LSFVKKPK+ +R Sbjct: 465 YKLDPRFVKKPTVAKKEKKRETLPEKMARKRRRLRKIRLSFVKKPKRMRR 514 >emb|CBI15328.3| unnamed protein product [Vitis vinifera] Length = 532 Score = 62.4 bits (150), Expect = 4e-08 Identities = 34/50 (68%), Positives = 37/50 (74%), Gaps = 1/50 (2%) Frame = -2 Query: 250 YKLDPRFMKKPT-AVKEKKRETLPEKMAXXXXXXXXXXLSFVKKPKKAQR 104 YKLDPRF+KKPT A KEKKRETLPEKMA LSFVKKPK+ +R Sbjct: 481 YKLDPRFVKKPTVAKKEKKRETLPEKMARKRRRLRKIRLSFVKKPKRMRR 530 >ref|XP_002514631.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223546235|gb|EEF47737.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 569 Score = 60.8 bits (146), Expect = 1e-07 Identities = 33/53 (62%), Positives = 37/53 (69%), Gaps = 1/53 (1%) Frame = -2 Query: 250 YKLDPRFMKKPTAVK-EKKRETLPEKMAXXXXXXXXXXLSFVKKPKKAQRRAY 95 YK+D ++MKKP AVK EKKRETLPEKMA LSFVKKPKK RR + Sbjct: 517 YKVDEKYMKKPKAVKKEKKRETLPEKMARKRRRLKQIRLSFVKKPKKMMRRPF 569