BLASTX nr result
ID: Atractylodes22_contig00022419
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00022419 (248 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK65758.1| GIGANTEA, partial [Chrysanthemum x morifolium] 108 3e-22 dbj|BAM67030.1| gigantea-like [Chrysanthemum seticuspe f. boreale] 108 3e-22 gb|AEK05861.1| gigantea-5 [Populus balsamifera] gi|339778013|gb|... 96 3e-18 ref|XP_002307516.1| predicted protein [Populus trichocarpa] gi|2... 96 3e-18 ref|XP_002524341.1| Protein GIGANTEA, putative [Ricinus communis... 95 7e-18 >gb|AFK65758.1| GIGANTEA, partial [Chrysanthemum x morifolium] Length = 1151 Score = 108 bits (271), Expect = 3e-22 Identities = 47/55 (85%), Positives = 53/55 (96%) Frame = +3 Query: 6 ATCGPAYQYLSIDVINWEADVGKCLTWEAHSRLATGMPIQYLDTAAKELGCPISI 170 A CGPAYQYL++DV +WE+DVGKCLTWEAHSR+ATGMPIQYL+TAAKELGCPISI Sbjct: 1097 AACGPAYQYLNVDVTDWESDVGKCLTWEAHSRIATGMPIQYLNTAAKELGCPISI 1151 >dbj|BAM67030.1| gigantea-like [Chrysanthemum seticuspe f. boreale] Length = 1145 Score = 108 bits (271), Expect = 3e-22 Identities = 47/55 (85%), Positives = 53/55 (96%) Frame = +3 Query: 6 ATCGPAYQYLSIDVINWEADVGKCLTWEAHSRLATGMPIQYLDTAAKELGCPISI 170 A CGPAYQYL++DV +WE+DVGKCLTWEAHSR+ATGMPIQYL+TAAKELGCPISI Sbjct: 1091 AACGPAYQYLNVDVTDWESDVGKCLTWEAHSRIATGMPIQYLNTAAKELGCPISI 1145 >gb|AEK05861.1| gigantea-5 [Populus balsamifera] gi|339778013|gb|AEK05866.1| gigantea-5 [Populus balsamifera] gi|339778019|gb|AEK05871.1| gigantea-5 [Populus balsamifera] gi|339778025|gb|AEK05876.1| gigantea-5 [Populus balsamifera] Length = 173 Score = 95.9 bits (237), Expect = 3e-18 Identities = 42/52 (80%), Positives = 47/52 (90%) Frame = +3 Query: 15 GPAYQYLSIDVINWEADVGKCLTWEAHSRLATGMPIQYLDTAAKELGCPISI 170 GP+YQYL DVINW+AD+ KCLTWEAHSRLATGMP+ +LDTAAKELGC ISI Sbjct: 122 GPSYQYLRSDVINWQADIEKCLTWEAHSRLATGMPVHHLDTAAKELGCTISI 173 >ref|XP_002307516.1| predicted protein [Populus trichocarpa] gi|222856965|gb|EEE94512.1| predicted protein [Populus trichocarpa] Length = 1171 Score = 95.9 bits (237), Expect = 3e-18 Identities = 42/52 (80%), Positives = 47/52 (90%) Frame = +3 Query: 15 GPAYQYLSIDVINWEADVGKCLTWEAHSRLATGMPIQYLDTAAKELGCPISI 170 GP+YQYL DVINW+AD+ KCLTWEAHSRLATGMP+ +LDTAAKELGC ISI Sbjct: 1120 GPSYQYLRSDVINWQADIEKCLTWEAHSRLATGMPVHHLDTAAKELGCTISI 1171 >ref|XP_002524341.1| Protein GIGANTEA, putative [Ricinus communis] gi|223536432|gb|EEF38081.1| Protein GIGANTEA, putative [Ricinus communis] Length = 1161 Score = 94.7 bits (234), Expect = 7e-18 Identities = 41/52 (78%), Positives = 47/52 (90%) Frame = +3 Query: 15 GPAYQYLSIDVINWEADVGKCLTWEAHSRLATGMPIQYLDTAAKELGCPISI 170 GP+YQY +IDV +W+ D+ KCLTWEAHSRLATGMPIQ+LDTAAKELGC ISI Sbjct: 1110 GPSYQYFNIDVTDWQTDIEKCLTWEAHSRLATGMPIQFLDTAAKELGCTISI 1161