BLASTX nr result
ID: Atractylodes22_contig00022328
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00022328 (219 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515023.1| ATP binding protein, putative [Ricinus commu... 55 8e-06 >ref|XP_002515023.1| ATP binding protein, putative [Ricinus communis] gi|223546074|gb|EEF47577.1| ATP binding protein, putative [Ricinus communis] Length = 1987 Score = 54.7 bits (130), Expect = 8e-06 Identities = 29/70 (41%), Positives = 42/70 (60%) Frame = -2 Query: 215 KLDVAYQTIKSLEDAMSRLKTSVSQFSQENEKSLDSRTVFESDIKKLKEEVEYHERKVSD 36 KL AY+TIKSLE A+S+ + + S S++N RT E+++KKLKEE E H ++ D Sbjct: 1011 KLTEAYRTIKSLEAALSQAEVNGSLLSEQNNHFQVERTDLENELKKLKEEAESHASRLED 1070 Query: 35 LVGEKKNAEQ 6 K E+ Sbjct: 1071 TTTTMKQLEE 1080