BLASTX nr result
ID: Atractylodes22_contig00022073
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00022073 (517 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530409.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 >ref|XP_002530409.1| conserved hypothetical protein [Ricinus communis] gi|223530058|gb|EEF31979.1| conserved hypothetical protein [Ricinus communis] Length = 440 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/51 (49%), Positives = 33/51 (64%) Frame = +2 Query: 2 VDELVILHKDASLKVEREDXXXXXXXXXXXXXXCKGKQFEAAWVKHKDDPN 154 VDELV+L+K+A+LK RE+ CKG QF++AW KH+DDPN Sbjct: 376 VDELVVLYKEAALKTAREEIRTNVLEILVLLQQCKGLQFQSAWDKHRDDPN 426