BLASTX nr result
ID: Atractylodes22_contig00022008
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00022008 (263 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABF59516.1| putative spindle disassembly related protein CDC4... 99 5e-20 ref|XP_003554388.1| PREDICTED: cell division cycle protein 48 ho... 99 7e-20 ref|XP_002282146.1| PREDICTED: cell division cycle protein 48 ho... 99 7e-20 pir||T48355 transitional endoplasmic reticulum ATPase - Arabidop... 99 9e-20 ref|NP_568114.1| cell division control protein 48-e [Arabidopsis... 99 9e-20 >gb|ABF59516.1| putative spindle disassembly related protein CDC48 [Nicotiana tabacum] Length = 808 Score = 99.0 bits (245), Expect(2) = 5e-20 Identities = 44/61 (72%), Positives = 52/61 (85%) Frame = +1 Query: 10 LVSKGKERTDTVCIALADETCDEPKIRMNKVIRKNLRIQLGDVAFVRQCPYVKYGKRTHA 189 ++ KGK+R DT+CIALAD+TCDEPKIRMNKV+R NLR++LGDV V QCP VKYGKR H Sbjct: 62 ILIKGKKRKDTICIALADDTCDEPKIRMNKVVRNNLRVRLGDVVSVHQCPDVKYGKRVHI 121 Query: 190 L 192 L Sbjct: 122 L 122 Score = 23.5 bits (49), Expect(2) = 5e-20 Identities = 11/17 (64%), Positives = 13/17 (76%), Gaps = 3/17 (17%) Frame = +3 Query: 192 PLDDR---VTGDLFDAY 233 P+DD VTG+LFDAY Sbjct: 123 PIDDTIEGVTGNLFDAY 139 >ref|XP_003554388.1| PREDICTED: cell division cycle protein 48 homolog [Glycine max] Length = 808 Score = 99.0 bits (245), Expect(2) = 7e-20 Identities = 45/61 (73%), Positives = 52/61 (85%) Frame = +1 Query: 10 LVSKGKERTDTVCIALADETCDEPKIRMNKVIRKNLRIQLGDVAFVRQCPYVKYGKRTHA 189 ++ KGK+R DTVCIALADETC+EPKIRMNKV+R NLR++LGDV V QCP VKYGKR H Sbjct: 62 ILIKGKKRKDTVCIALADETCEEPKIRMNKVVRNNLRVRLGDVVSVHQCPDVKYGKRVHI 121 Query: 190 L 192 L Sbjct: 122 L 122 Score = 23.1 bits (48), Expect(2) = 7e-20 Identities = 11/17 (64%), Positives = 13/17 (76%), Gaps = 3/17 (17%) Frame = +3 Query: 192 PLDDR---VTGDLFDAY 233 P+DD VTG+LFDAY Sbjct: 123 PVDDTIEGVTGNLFDAY 139 >ref|XP_002282146.1| PREDICTED: cell division cycle protein 48 homolog [Vitis vinifera] gi|297741633|emb|CBI32765.3| unnamed protein product [Vitis vinifera] Length = 806 Score = 99.0 bits (245), Expect(2) = 7e-20 Identities = 44/61 (72%), Positives = 52/61 (85%) Frame = +1 Query: 10 LVSKGKERTDTVCIALADETCDEPKIRMNKVIRKNLRIQLGDVAFVRQCPYVKYGKRTHA 189 ++ KGK+R DT+CIALAD+TCDEPKIRMNKV+R NLR++LGDV V QCP VKYGKR H Sbjct: 62 ILIKGKKRKDTICIALADDTCDEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVHI 121 Query: 190 L 192 L Sbjct: 122 L 122 Score = 23.1 bits (48), Expect(2) = 7e-20 Identities = 11/17 (64%), Positives = 13/17 (76%), Gaps = 3/17 (17%) Frame = +3 Query: 192 PLDDR---VTGDLFDAY 233 P+DD VTG+LFDAY Sbjct: 123 PVDDTIEGVTGNLFDAY 139 >pir||T48355 transitional endoplasmic reticulum ATPase - Arabidopsis thaliana gi|7378614|emb|CAB83290.1| transitional endoplasmic reticulum ATPase [Arabidopsis thaliana] Length = 843 Score = 98.6 bits (244), Expect(2) = 9e-20 Identities = 45/61 (73%), Positives = 52/61 (85%) Frame = +1 Query: 10 LVSKGKERTDTVCIALADETCDEPKIRMNKVIRKNLRIQLGDVAFVRQCPYVKYGKRTHA 189 ++ KGK+R DTVCIALADETC+EPKIRMNKV+R NLR++LGDV V QCP VKYGKR H Sbjct: 94 ILIKGKKRKDTVCIALADETCEEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGKRVHI 153 Query: 190 L 192 L Sbjct: 154 L 154 Score = 23.1 bits (48), Expect(2) = 9e-20 Identities = 11/17 (64%), Positives = 13/17 (76%), Gaps = 3/17 (17%) Frame = +3 Query: 192 PLDDRV---TGDLFDAY 233 P+DD V TG+LFDAY Sbjct: 155 PVDDTVEGVTGNLFDAY 171 >ref|NP_568114.1| cell division control protein 48-e [Arabidopsis thaliana] gi|28201771|sp|Q9LZF6.2|CD48E_ARATH RecName: Full=Cell division control protein 48 homolog E; Short=AtCDC48e; AltName: Full=Transitional endoplasmic reticulum ATPase E gi|26449352|dbj|BAC41803.1| putative transitional endoplasmic reticulum ATPase [Arabidopsis thaliana] gi|26452166|dbj|BAC43171.1| putative transitional endoplasmic reticulum ATPase [Arabidopsis thaliana] gi|30102750|gb|AAP21293.1| At5g03340 [Arabidopsis thaliana] gi|332003204|gb|AED90587.1| cell division control protein 48-e [Arabidopsis thaliana] Length = 810 Score = 98.6 bits (244), Expect(2) = 9e-20 Identities = 45/61 (73%), Positives = 52/61 (85%) Frame = +1 Query: 10 LVSKGKERTDTVCIALADETCDEPKIRMNKVIRKNLRIQLGDVAFVRQCPYVKYGKRTHA 189 ++ KGK+R DTVCIALADETC+EPKIRMNKV+R NLR++LGDV V QCP VKYGKR H Sbjct: 61 ILIKGKKRKDTVCIALADETCEEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGKRVHI 120 Query: 190 L 192 L Sbjct: 121 L 121 Score = 23.1 bits (48), Expect(2) = 9e-20 Identities = 11/17 (64%), Positives = 13/17 (76%), Gaps = 3/17 (17%) Frame = +3 Query: 192 PLDDRV---TGDLFDAY 233 P+DD V TG+LFDAY Sbjct: 122 PVDDTVEGVTGNLFDAY 138