BLASTX nr result
ID: Atractylodes22_contig00021693
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00021693 (349 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002870199.1| At4g15930 [Arabidopsis lyrata subsp. lyrata]... 68 9e-10 ref|XP_002328627.1| predicted protein [Populus trichocarpa] gi|1... 68 9e-10 ref|NP_193328.4| dynein light chain LC8-type [Arabidopsis thalia... 67 1e-09 gb|AAL57365.1|AF404866_1 neuronal nitric oxide synthase protein ... 67 1e-09 emb|CAB46031.1| dynein light chain like protein [Arabidopsis tha... 67 1e-09 >ref|XP_002870199.1| At4g15930 [Arabidopsis lyrata subsp. lyrata] gi|297316035|gb|EFH46458.1| At4g15930 [Arabidopsis lyrata subsp. lyrata] Length = 123 Score = 67.8 bits (164), Expect = 9e-10 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = -1 Query: 127 DMKEEMQSEAVNIAISAFENLSVEKDIAEQIKKEFDKNHGPT 2 DMK++MQ EA++IAISAFE SVEKDIAE IKKEFDK HG T Sbjct: 46 DMKDDMQKEAIDIAISAFEKYSVEKDIAENIKKEFDKKHGAT 87 >ref|XP_002328627.1| predicted protein [Populus trichocarpa] gi|118482080|gb|ABK92971.1| unknown [Populus trichocarpa] gi|222838609|gb|EEE76974.1| predicted protein [Populus trichocarpa] Length = 120 Score = 67.8 bits (164), Expect = 9e-10 Identities = 31/42 (73%), Positives = 37/42 (88%) Frame = -1 Query: 127 DMKEEMQSEAVNIAISAFENLSVEKDIAEQIKKEFDKNHGPT 2 DMK++MQ EAV+IAI+AFE +VEKD+AE IKKEFDK HGPT Sbjct: 43 DMKDDMQKEAVDIAIAAFERNNVEKDVAEHIKKEFDKKHGPT 84 >ref|NP_193328.4| dynein light chain LC8-type [Arabidopsis thaliana] gi|28466885|gb|AAO44051.1| At4g15930 [Arabidopsis thaliana] gi|332658267|gb|AEE83667.1| dynein light chain LC8-type [Arabidopsis thaliana] Length = 123 Score = 67.4 bits (163), Expect = 1e-09 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -1 Query: 127 DMKEEMQSEAVNIAISAFENLSVEKDIAEQIKKEFDKNHGPT 2 DMK++MQ EA+ IAISAFE SVEKDIAE IKKEFDK HG T Sbjct: 46 DMKDDMQKEAIEIAISAFEKYSVEKDIAENIKKEFDKKHGAT 87 >gb|AAL57365.1|AF404866_1 neuronal nitric oxide synthase protein inhibitor [Arabidopsis thaliana] Length = 103 Score = 67.4 bits (163), Expect = 1e-09 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -1 Query: 127 DMKEEMQSEAVNIAISAFENLSVEKDIAEQIKKEFDKNHGPT 2 DMK++MQ EA+ IAISAFE SVEKDIAE IKKEFDK HG T Sbjct: 26 DMKDDMQKEAIEIAISAFEKYSVEKDIAENIKKEFDKKHGAT 67 >emb|CAB46031.1| dynein light chain like protein [Arabidopsis thaliana] gi|7268341|emb|CAB78635.1| dynein light chain like protein [Arabidopsis thaliana] Length = 103 Score = 67.4 bits (163), Expect = 1e-09 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -1 Query: 127 DMKEEMQSEAVNIAISAFENLSVEKDIAEQIKKEFDKNHGPT 2 DMK++MQ EA+ IAISAFE SVEKDIAE IKKEFDK HG T Sbjct: 26 DMKDDMQKEAIEIAISAFEKYSVEKDIAENIKKEFDKKHGAT 67