BLASTX nr result
ID: Atractylodes22_contig00021641
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00021641 (555 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002539968.1| conserved hypothetical protein [Ricinus comm... 62 5e-08 >ref|XP_002539968.1| conserved hypothetical protein [Ricinus communis] gi|223500659|gb|EEF22415.1| conserved hypothetical protein [Ricinus communis] Length = 118 Score = 62.4 bits (150), Expect = 5e-08 Identities = 36/91 (39%), Positives = 42/91 (46%), Gaps = 1/91 (1%) Frame = -3 Query: 475 GFR-WNSPIPYLFGGXXXXXXXXXXXXXXXXCXXXXXXXXXXXXXXXSTGDQEKQSVPEF 299 GF+ WNSP+PYLFGG C +EK Sbjct: 18 GFQHWNSPVPYLFGGLALMLGLIAMALMILACSYKNSSPSNNSSPRDHQAAEEKSRHDHK 77 Query: 298 RMELPLEMEPKIVIVMPGDINPTYLAKPTPP 206 R EL +EMEPKIV++M GD NPTY AKP P Sbjct: 78 RAELQMEMEPKIVVIMAGDHNPTYFAKPAVP 108