BLASTX nr result
ID: Atractylodes22_contig00021482
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00021482 (331 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEO32896.1| hypothetical protein [Amblyomma maculatum] 60 2e-07 emb|CBI19009.3| unnamed protein product [Vitis vinifera] 55 6e-06 ref|NP_001241296.1| uncharacterized protein LOC100778176 [Glycin... 55 6e-06 ref|XP_002513750.1| conserved hypothetical protein [Ricinus comm... 55 6e-06 ref|XP_002285862.1| PREDICTED: acetyltransferase At1g77540 [Viti... 55 6e-06 >gb|AEO32896.1| hypothetical protein [Amblyomma maculatum] Length = 141 Score = 59.7 bits (143), Expect = 2e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +1 Query: 1 PTCSYISDTFLPRNPSWKSVLYSEDLKSSI 90 PTCSYISDTFLPRNPSW +V+Y+E+LKSSI Sbjct: 112 PTCSYISDTFLPRNPSWSAVVYTEELKSSI 141 >emb|CBI19009.3| unnamed protein product [Vitis vinifera] Length = 67 Score = 55.1 bits (131), Expect = 6e-06 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = +1 Query: 1 PTCSYISDTFLPRNPSWKSVLYSEDLKSSI 90 P+CSY+SDTFLPRNPSW S++YSE+ KSS+ Sbjct: 38 PSCSYVSDTFLPRNPSWNSLVYSEEPKSSM 67 >ref|NP_001241296.1| uncharacterized protein LOC100778176 [Glycine max] gi|255638882|gb|ACU19743.1| unknown [Glycine max] Length = 117 Score = 55.1 bits (131), Expect = 6e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +1 Query: 1 PTCSYISDTFLPRNPSWKSVLYSEDLKSSI 90 PTCSY+SDTFLPRNPSW SV+Y+E KS+I Sbjct: 88 PTCSYVSDTFLPRNPSWNSVVYTEGGKSNI 117 >ref|XP_002513750.1| conserved hypothetical protein [Ricinus communis] gi|223546836|gb|EEF48333.1| conserved hypothetical protein [Ricinus communis] Length = 112 Score = 55.1 bits (131), Expect = 6e-06 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = +1 Query: 1 PTCSYISDTFLPRNPSWKSVLYSEDLKSSI 90 P+CSY+SDTFLPRN SW SV++SED+KS+I Sbjct: 83 PSCSYVSDTFLPRNESWNSVVFSEDIKSNI 112 >ref|XP_002285862.1| PREDICTED: acetyltransferase At1g77540 [Vitis vinifera] Length = 111 Score = 55.1 bits (131), Expect = 6e-06 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = +1 Query: 1 PTCSYISDTFLPRNPSWKSVLYSEDLKSSI 90 P+CSY+SDTFLPRNPSW S++YSE+ KSS+ Sbjct: 82 PSCSYVSDTFLPRNPSWNSLVYSEEPKSSM 111