BLASTX nr result
ID: Atractylodes22_contig00021399
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00021399 (216 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN82842.1| hypothetical protein VITISV_019567 [Vitis vinifera] 60 2e-07 emb|CBI39569.3| unnamed protein product [Vitis vinifera] 57 1e-06 >emb|CAN82842.1| hypothetical protein VITISV_019567 [Vitis vinifera] Length = 586 Score = 60.1 bits (144), Expect = 2e-07 Identities = 29/41 (70%), Positives = 34/41 (82%), Gaps = 1/41 (2%) Frame = +3 Query: 27 DFGICFSRRGSPRARWCKIRAAVKW-VSVMRNVAAKRMATL 146 +FGI SR+G PRARWCKIRAA+KW +SV R+VAAKRM L Sbjct: 537 NFGIGMSRKGKPRARWCKIRAALKWGISVRRDVAAKRMEKL 577 >emb|CBI39569.3| unnamed protein product [Vitis vinifera] Length = 589 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/38 (71%), Positives = 32/38 (84%), Gaps = 1/38 (2%) Frame = +3 Query: 27 DFGICFSRRGSPRARWCKIRAAVKW-VSVMRNVAAKRM 137 +FGI SR+G PRARWCKIRAA+KW +SV R+V AKRM Sbjct: 539 NFGIGMSRKGKPRARWCKIRAALKWGISVRRDVEAKRM 576