BLASTX nr result
ID: Atractylodes22_contig00021106
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00021106 (309 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002330194.1| predicted protein [Populus trichocarpa] gi|2... 67 1e-09 gb|AFK39818.1| unknown [Medicago truncatula] 67 2e-09 ref|XP_003591211.1| Universal stress protein A-like protein [Med... 67 2e-09 gb|ABB13620.1| USP-like protein [Astragalus sinicus] 67 2e-09 ref|XP_002526987.1| conserved hypothetical protein [Ricinus comm... 66 3e-09 >ref|XP_002330194.1| predicted protein [Populus trichocarpa] gi|222871650|gb|EEF08781.1| predicted protein [Populus trichocarpa] Length = 166 Score = 67.0 bits (162), Expect = 1e-09 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = +2 Query: 2 LLVLGSHGRGALKRVFLGSVSNHCVQNVRCPVLVVKK 112 ++V+GSHG G +KR FLGSVSNHCVQNV+CPVL+VKK Sbjct: 122 VVVMGSHGHGLIKRAFLGSVSNHCVQNVKCPVLIVKK 158 >gb|AFK39818.1| unknown [Medicago truncatula] Length = 154 Score = 66.6 bits (161), Expect = 2e-09 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +2 Query: 2 LLVLGSHGRGALKRVFLGSVSNHCVQNVRCPVLVVKK 112 +LV+GSHG G +KR FLGSVSNHC QNV+CPVL+VKK Sbjct: 109 ILVMGSHGYGVIKRAFLGSVSNHCAQNVKCPVLIVKK 145 >ref|XP_003591211.1| Universal stress protein A-like protein [Medicago truncatula] gi|355480259|gb|AES61462.1| Universal stress protein A-like protein [Medicago truncatula] Length = 165 Score = 66.6 bits (161), Expect = 2e-09 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +2 Query: 2 LLVLGSHGRGALKRVFLGSVSNHCVQNVRCPVLVVKK 112 +LV+GSHG G +KR FLGSVSNHC QNV+CPVL+VKK Sbjct: 120 ILVMGSHGYGVIKRAFLGSVSNHCAQNVKCPVLIVKK 156 >gb|ABB13620.1| USP-like protein [Astragalus sinicus] Length = 179 Score = 66.6 bits (161), Expect = 2e-09 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +2 Query: 2 LLVLGSHGRGALKRVFLGSVSNHCVQNVRCPVLVVKK 112 +LV+GSHG G +KR FLGSVSNHC QNV+CPVL+VKK Sbjct: 120 ILVMGSHGYGVIKRAFLGSVSNHCAQNVKCPVLIVKK 156 >ref|XP_002526987.1| conserved hypothetical protein [Ricinus communis] gi|223533622|gb|EEF35359.1| conserved hypothetical protein [Ricinus communis] Length = 160 Score = 66.2 bits (160), Expect = 3e-09 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +2 Query: 2 LLVLGSHGRGALKRVFLGSVSNHCVQNVRCPVLVVKK 112 LLVLGSH RGA+KR FLGSVSN+CV N +CPVLVVKK Sbjct: 122 LLVLGSHSRGAIKRAFLGSVSNYCVHNAKCPVLVVKK 158