BLASTX nr result
ID: Atractylodes22_contig00020921
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00020921 (238 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002264696.1| PREDICTED: pentatricopeptide repeat-containi... 133 2e-29 emb|CAN60200.1| hypothetical protein VITISV_039678 [Vitis vinifera] 132 4e-29 ref|XP_002306265.1| predicted protein [Populus trichocarpa] gi|2... 127 1e-27 ref|XP_002512558.1| pentatricopeptide repeat-containing protein,... 126 2e-27 ref|XP_004146407.1| PREDICTED: pentatricopeptide repeat-containi... 123 1e-26 >ref|XP_002264696.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial [Vitis vinifera] gi|296088528|emb|CBI37519.3| unnamed protein product [Vitis vinifera] Length = 525 Score = 133 bits (334), Expect = 2e-29 Identities = 61/78 (78%), Positives = 74/78 (94%) Frame = -3 Query: 236 QRGIDPDVTSYSIVLHVYSRAHKPGLTREKLKMMKDKGIHPTLASYTSVVKCLCSCGRLQ 57 Q+GI+PDVTSYSIV+HVYSRAHKP LT +KL+MMKDKGI PT+A+YTSVVKCLCSCGRL+ Sbjct: 295 QKGIEPDVTSYSIVIHVYSRAHKPELTLDKLRMMKDKGIWPTVATYTSVVKCLCSCGRLE 354 Query: 56 DAEELLDEMVRNGVTPSA 3 DAEEL+ +MV++GV+PSA Sbjct: 355 DAEELVSDMVKDGVSPSA 372 >emb|CAN60200.1| hypothetical protein VITISV_039678 [Vitis vinifera] Length = 525 Score = 132 bits (331), Expect = 4e-29 Identities = 61/78 (78%), Positives = 73/78 (93%) Frame = -3 Query: 236 QRGIDPDVTSYSIVLHVYSRAHKPGLTREKLKMMKDKGIHPTLASYTSVVKCLCSCGRLQ 57 Q GI+PDVTSYSIV+HVYSRAHKP LT +KL+MMKDKGI PT+A+YTSVVKCLCSCGRL+ Sbjct: 295 QXGIEPDVTSYSIVIHVYSRAHKPELTLDKLRMMKDKGIWPTVATYTSVVKCLCSCGRLE 354 Query: 56 DAEELLDEMVRNGVTPSA 3 DAEEL+ +MV++GV+PSA Sbjct: 355 DAEELVSDMVKDGVSPSA 372 >ref|XP_002306265.1| predicted protein [Populus trichocarpa] gi|222855714|gb|EEE93261.1| predicted protein [Populus trichocarpa] Length = 548 Score = 127 bits (318), Expect = 1e-27 Identities = 59/78 (75%), Positives = 72/78 (92%) Frame = -3 Query: 236 QRGIDPDVTSYSIVLHVYSRAHKPGLTREKLKMMKDKGIHPTLASYTSVVKCLCSCGRLQ 57 +RGI+PDVTS+SIVLHVYSRAHKP LT +KLK+MK+KGI P++ +YTSVVKCLCSCGR++ Sbjct: 318 ERGIEPDVTSFSIVLHVYSRAHKPELTLDKLKLMKEKGICPSVVTYTSVVKCLCSCGRIE 377 Query: 56 DAEELLDEMVRNGVTPSA 3 DAEELL EMVRNGV+ +A Sbjct: 378 DAEELLGEMVRNGVSRTA 395 >ref|XP_002512558.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223548519|gb|EEF50010.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 511 Score = 126 bits (316), Expect = 2e-27 Identities = 57/78 (73%), Positives = 73/78 (93%) Frame = -3 Query: 236 QRGIDPDVTSYSIVLHVYSRAHKPGLTREKLKMMKDKGIHPTLASYTSVVKCLCSCGRLQ 57 Q+GI+PDVTS+SI+LHVYSRAHKP LT +KLK+M++ GI PT+A+YTSV+KCLCSCGR+ Sbjct: 281 QKGIEPDVTSFSILLHVYSRAHKPQLTVDKLKLMEEMGICPTVATYTSVLKCLCSCGRID 340 Query: 56 DAEELLDEMVRNGVTPSA 3 DAEELL++MVRNGV+P+A Sbjct: 341 DAEELLEQMVRNGVSPNA 358 >ref|XP_004146407.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Cucumis sativus] gi|449523938|ref|XP_004168980.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Cucumis sativus] Length = 506 Score = 123 bits (309), Expect = 1e-26 Identities = 55/77 (71%), Positives = 70/77 (90%) Frame = -3 Query: 236 QRGIDPDVTSYSIVLHVYSRAHKPGLTREKLKMMKDKGIHPTLASYTSVVKCLCSCGRLQ 57 +RGI+PDVTS+SIVLHVYSRAHKP L+ +KLK MK+ GI PT+A+YTSV+KCLCSCGRL+ Sbjct: 276 KRGIEPDVTSFSIVLHVYSRAHKPELSLDKLKQMKELGISPTVATYTSVIKCLCSCGRLE 335 Query: 56 DAEELLDEMVRNGVTPS 6 D E L++EMVR+G++PS Sbjct: 336 DGENLIEEMVRSGISPS 352