BLASTX nr result
ID: Atractylodes22_contig00020833
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00020833 (329 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002264587.1| PREDICTED: CTP synthase 1 [Vitis vinifera] g... 59 4e-07 emb|CAN82720.1| hypothetical protein VITISV_008042 [Vitis vinifera] 59 4e-07 ref|XP_002265957.1| PREDICTED: CTP synthase [Vitis vinifera] gi|... 58 7e-07 ref|NP_193765.3| putative CTP synthase [Arabidopsis thaliana] gi... 57 1e-06 emb|CAA18258.1| CTP synthase like protein [Arabidopsis thaliana]... 57 1e-06 >ref|XP_002264587.1| PREDICTED: CTP synthase 1 [Vitis vinifera] gi|297738179|emb|CBI27380.3| unnamed protein product [Vitis vinifera] Length = 605 Score = 58.9 bits (141), Expect = 4e-07 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -1 Query: 152 LEYARSILGLQNANSTEFDQNTNNPCVIFMPE 57 +E+ARS+LGL++ANSTEFD NT NPCVIFMPE Sbjct: 406 IEFARSVLGLKDANSTEFDPNTKNPCVIFMPE 437 >emb|CAN82720.1| hypothetical protein VITISV_008042 [Vitis vinifera] Length = 612 Score = 58.9 bits (141), Expect = 4e-07 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -1 Query: 152 LEYARSILGLQNANSTEFDQNTNNPCVIFMPE 57 +E+ARS+LGL++ANSTEFD NT NPCVIFMPE Sbjct: 393 IEFARSVLGLKDANSTEFDPNTKNPCVIFMPE 424 >ref|XP_002265957.1| PREDICTED: CTP synthase [Vitis vinifera] gi|297736081|emb|CBI24119.3| unnamed protein product [Vitis vinifera] Length = 595 Score = 58.2 bits (139), Expect = 7e-07 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -1 Query: 152 LEYARSILGLQNANSTEFDQNTNNPCVIFMPE 57 +E+ARS+LGLQ+ANSTEFD T NPCVIFMPE Sbjct: 406 IEFARSVLGLQDANSTEFDPKTKNPCVIFMPE 437 >ref|NP_193765.3| putative CTP synthase [Arabidopsis thaliana] gi|145333471|ref|NP_001078411.1| putative CTP synthase [Arabidopsis thaliana] gi|110736296|dbj|BAF00118.1| CTP synthase like protein [Arabidopsis thaliana] gi|332658905|gb|AEE84305.1| putative CTP synthase [Arabidopsis thaliana] gi|332658906|gb|AEE84306.1| putative CTP synthase [Arabidopsis thaliana] Length = 597 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = -1 Query: 161 LQCLEYARSILGLQNANSTEFDQNTNNPCVIFMPE 57 L +EYAR+ILGL +ANSTE D NT NPCVIFMPE Sbjct: 403 LAVIEYARTILGLADANSTELDPNTKNPCVIFMPE 437 >emb|CAA18258.1| CTP synthase like protein [Arabidopsis thaliana] gi|7268827|emb|CAB79032.1| CTP synthase like protein [Arabidopsis thaliana] Length = 553 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = -1 Query: 161 LQCLEYARSILGLQNANSTEFDQNTNNPCVIFMPE 57 L +EYAR+ILGL +ANSTE D NT NPCVIFMPE Sbjct: 393 LAVIEYARTILGLADANSTELDPNTKNPCVIFMPE 427