BLASTX nr result
ID: Atractylodes22_contig00020633
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00020633 (352 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004147882.1| PREDICTED: uncharacterized protein LOC101207... 55 8e-06 >ref|XP_004147882.1| PREDICTED: uncharacterized protein LOC101207273 [Cucumis sativus] gi|449511613|ref|XP_004164006.1| PREDICTED: uncharacterized LOC101207273 [Cucumis sativus] Length = 675 Score = 54.7 bits (130), Expect = 8e-06 Identities = 33/93 (35%), Positives = 38/93 (40%), Gaps = 2/93 (2%) Frame = -1 Query: 352 EKEMNPNYWLYHCNKCDNSFHGKCIGNRDRYANCQWEGTGSVSYHKHPLTYVRRKKTPRY 173 E+E NPN YHC C H +CI W GS HKHPL V K Sbjct: 576 EEERNPNVCFYHCKTCHLMAHPECI-----LGEYPWLKYGSYETHKHPLALVTEGKKNFS 630 Query: 172 VCFGCNHDVNGHLILECRTGTCPFRI--CGPCH 80 C C G+L ECR C F + G C+ Sbjct: 631 DCDHCGKPCTGNLAYECR--RCKFNVHAIGRCY 661