BLASTX nr result
ID: Atractylodes22_contig00020614
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00020614 (409 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI16818.3| unnamed protein product [Vitis vinifera] 58 7e-07 emb|CAN81849.1| hypothetical protein VITISV_036820 [Vitis vinifera] 58 7e-07 ref|XP_002282194.2| PREDICTED: uncharacterized protein LOC100245... 56 3e-06 ref|XP_002515056.1| Nucleoporin GLE1, putative [Ricinus communis... 56 3e-06 >emb|CBI16818.3| unnamed protein product [Vitis vinifera] Length = 701 Score = 58.2 bits (139), Expect = 7e-07 Identities = 28/47 (59%), Positives = 37/47 (78%), Gaps = 1/47 (2%) Frame = -2 Query: 141 MGGVQLELRCPQRVGGIIA-DPQIDWSFDELLSELNTIDHTLQASSL 4 MG V+LELRCPQ GIIA DP+ DWSF+ L+SELN+++ L +SS+ Sbjct: 40 MGAVKLELRCPQNENGIIAADPEPDWSFEALVSELNSLELKLNSSSI 86 >emb|CAN81849.1| hypothetical protein VITISV_036820 [Vitis vinifera] Length = 745 Score = 58.2 bits (139), Expect = 7e-07 Identities = 28/47 (59%), Positives = 37/47 (78%), Gaps = 1/47 (2%) Frame = -2 Query: 141 MGGVQLELRCPQRVGGIIA-DPQIDWSFDELLSELNTIDHTLQASSL 4 MG V+LELRCPQ GIIA DP+ DWSF+ L+SELN+++ L +SS+ Sbjct: 70 MGAVKLELRCPQNENGIIAADPEPDWSFEALVSELNSLELKLNSSSI 116 >ref|XP_002282194.2| PREDICTED: uncharacterized protein LOC100245667 [Vitis vinifera] Length = 680 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/46 (58%), Positives = 36/46 (78%), Gaps = 1/46 (2%) Frame = -2 Query: 138 GGVQLELRCPQRVGGIIA-DPQIDWSFDELLSELNTIDHTLQASSL 4 G V+LELRCPQ GIIA DP+ DWSF+ L+SELN+++ L +SS+ Sbjct: 24 GAVKLELRCPQNENGIIAADPEPDWSFEALVSELNSLELKLNSSSI 69 >ref|XP_002515056.1| Nucleoporin GLE1, putative [Ricinus communis] gi|223546107|gb|EEF47610.1| Nucleoporin GLE1, putative [Ricinus communis] Length = 613 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/46 (56%), Positives = 33/46 (71%) Frame = -2 Query: 144 IMGGVQLELRCPQRVGGIIADPQIDWSFDELLSELNTIDHTLQASS 7 I G +LELRCPQRV + DP DWSFD LLSEL+++++ L SS Sbjct: 2 IRGAFKLELRCPQRVNEVGVDPNPDWSFDSLLSELSSLENKLNNSS 47