BLASTX nr result
ID: Atractylodes22_contig00020529
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00020529 (298 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004168158.1| PREDICTED: shaggy-related protein kinase the... 62 6e-08 ref|XP_004144981.1| PREDICTED: shaggy-related protein kinase the... 62 6e-08 emb|CAC08564.1| wound-induced GSK-3-like protein [Medicago sativ... 60 1e-07 ref|XP_002276754.2| PREDICTED: shaggy-related protein kinase eps... 60 2e-07 ref|XP_003521276.1| PREDICTED: shaggy-related protein kinase the... 60 2e-07 >ref|XP_004168158.1| PREDICTED: shaggy-related protein kinase theta-like [Cucumis sativus] Length = 469 Score = 61.6 bits (148), Expect = 6e-08 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -1 Query: 298 ELIFGATEYTNAIDMWSVGCVLAELLLGQ 212 ELIFGATEYTNAIDMWSVGCV+AELLLGQ Sbjct: 310 ELIFGATEYTNAIDMWSVGCVMAELLLGQ 338 >ref|XP_004144981.1| PREDICTED: shaggy-related protein kinase theta-like [Cucumis sativus] gi|449473157|ref|XP_004153803.1| PREDICTED: shaggy-related protein kinase theta-like [Cucumis sativus] Length = 469 Score = 61.6 bits (148), Expect = 6e-08 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -1 Query: 298 ELIFGATEYTNAIDMWSVGCVLAELLLGQ 212 ELIFGATEYTNAIDMWSVGCV+AELLLGQ Sbjct: 310 ELIFGATEYTNAIDMWSVGCVMAELLLGQ 338 >emb|CAC08564.1| wound-induced GSK-3-like protein [Medicago sativa subsp. x varia] Length = 468 Score = 60.5 bits (145), Expect = 1e-07 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -1 Query: 298 ELIFGATEYTNAIDMWSVGCVLAELLLGQVCLI 200 ELIFGATEYT AIDMWSVGCVLAELLLGQ + Sbjct: 309 ELIFGATEYTTAIDMWSVGCVLAELLLGQAMFL 341 >ref|XP_002276754.2| PREDICTED: shaggy-related protein kinase epsilon [Vitis vinifera] Length = 416 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -1 Query: 298 ELIFGATEYTNAIDMWSVGCVLAELLLGQ 212 ELIFGATEYT AIDMWSVGCVLAELLLGQ Sbjct: 246 ELIFGATEYTTAIDMWSVGCVLAELLLGQ 274 >ref|XP_003521276.1| PREDICTED: shaggy-related protein kinase theta [Glycine max] Length = 470 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -1 Query: 298 ELIFGATEYTNAIDMWSVGCVLAELLLGQ 212 ELIFGATEYT AIDMWSVGCVLAELLLGQ Sbjct: 311 ELIFGATEYTTAIDMWSVGCVLAELLLGQ 339