BLASTX nr result
ID: Atractylodes22_contig00020095
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00020095 (570 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002263742.1| PREDICTED: probable inositol transporter 1 [... 92 6e-17 gb|AAO74897.1| putative Na+/myo-inositol symporter [Mesembryanth... 91 1e-16 ref|XP_004152124.1| PREDICTED: inositol transporter 1-like [Cucu... 87 2e-15 gb|ABO21769.1| sugar transporter protein [Ananas comosus] 85 9e-15 ref|NP_850393.1| putative inositol transporter 1 [Arabidopsis th... 84 2e-14 >ref|XP_002263742.1| PREDICTED: probable inositol transporter 1 [Vitis vinifera] gi|297743762|emb|CBI36645.3| unnamed protein product [Vitis vinifera] gi|310877896|gb|ADP37179.1| putative inositol transporter [Vitis vinifera] Length = 499 Score = 92.0 bits (227), Expect = 6e-17 Identities = 43/58 (74%), Positives = 51/58 (87%) Frame = +3 Query: 396 MTIDLIPGSSGRIDAGVDKKITYFSNKYVLGLTVVAGIGGLLFGYDTGVVSGALLYIR 569 MTID +PGSSG +D+ ++ITYFSN Y+LGLT VAGIGGLLFGYDTGV+SGALLYI+ Sbjct: 1 MTIDSLPGSSGYLDSYPGRRITYFSNGYILGLTAVAGIGGLLFGYDTGVISGALLYIK 58 >gb|AAO74897.1| putative Na+/myo-inositol symporter [Mesembryanthemum crystallinum] Length = 498 Score = 90.9 bits (224), Expect = 1e-16 Identities = 42/58 (72%), Positives = 51/58 (87%) Frame = +3 Query: 396 MTIDLIPGSSGRIDAGVDKKITYFSNKYVLGLTVVAGIGGLLFGYDTGVVSGALLYIR 569 MT+D IPGSSG +D+ +++ITYF NK+VL LTV AGIGGLLFGYDTGV+SGALLYI+ Sbjct: 1 MTLDSIPGSSGYLDSYPERRITYFGNKFVLALTVTAGIGGLLFGYDTGVISGALLYIK 58 >ref|XP_004152124.1| PREDICTED: inositol transporter 1-like [Cucumis sativus] gi|449484700|ref|XP_004156956.1| PREDICTED: inositol transporter 1-like [Cucumis sativus] Length = 495 Score = 87.0 bits (214), Expect = 2e-15 Identities = 40/58 (68%), Positives = 50/58 (86%) Frame = +3 Query: 396 MTIDLIPGSSGRIDAGVDKKITYFSNKYVLGLTVVAGIGGLLFGYDTGVVSGALLYIR 569 +T++ +PGSSG +D ++K+ YF N YVLGLTVVAGIGGLLFGYDTGV+SGALLYI+ Sbjct: 3 LTLESLPGSSGYLDIYPERKMYYFKNPYVLGLTVVAGIGGLLFGYDTGVISGALLYIK 60 >gb|ABO21769.1| sugar transporter protein [Ananas comosus] Length = 511 Score = 84.7 bits (208), Expect = 9e-15 Identities = 42/59 (71%), Positives = 50/59 (84%), Gaps = 1/59 (1%) Frame = +3 Query: 396 MTIDL-IPGSSGRIDAGVDKKITYFSNKYVLGLTVVAGIGGLLFGYDTGVVSGALLYIR 569 MTID +PGSSG +D+ + +++FSN YVLGLTV AGIGGLLFGYDTGV+SGALLYIR Sbjct: 1 MTIDFSMPGSSGILDSPAKRDMSFFSNGYVLGLTVTAGIGGLLFGYDTGVISGALLYIR 59 >ref|NP_850393.1| putative inositol transporter 1 [Arabidopsis thaliana] gi|75331205|sp|Q8VZR6.1|INT1_ARATH RecName: Full=Inositol transporter 1 gi|17380890|gb|AAL36257.1| putative membrane transporter protein [Arabidopsis thaliana] gi|20465939|gb|AAM20155.1| putative membrane transporter protein [Arabidopsis thaliana] gi|84617967|emb|CAJ00303.1| inositol transporter 1 [Arabidopsis thaliana] gi|330255158|gb|AEC10252.1| putative inositol transporter 1 [Arabidopsis thaliana] Length = 509 Score = 83.6 bits (205), Expect = 2e-14 Identities = 38/58 (65%), Positives = 48/58 (82%) Frame = +3 Query: 396 MTIDLIPGSSGRIDAGVDKKITYFSNKYVLGLTVVAGIGGLLFGYDTGVVSGALLYIR 569 +TI PGSSG +D +++++YF N Y+LGLTV AGIGGLLFGYDTGV+SGALLYI+ Sbjct: 3 LTIPNAPGSSGYLDMFPERRMSYFGNSYILGLTVTAGIGGLLFGYDTGVISGALLYIK 60