BLASTX nr result
ID: Atractylodes22_contig00020054
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00020054 (617 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528871.1| conserved hypothetical protein [Ricinus comm... 69 9e-10 ref|XP_002528203.1| conserved hypothetical protein [Ricinus comm... 67 3e-09 ref|XP_003631036.1| hypothetical protein MTR_8g106450 [Medicago ... 65 1e-08 ref|XP_003621634.1| Serine carboxypeptidase-like protein [Medica... 64 2e-08 gb|AAC17621.1| Similar to seryl-tRNA synthetase gb|U10400 from S... 64 3e-08 >ref|XP_002528871.1| conserved hypothetical protein [Ricinus communis] gi|223531670|gb|EEF33495.1| conserved hypothetical protein [Ricinus communis] Length = 94 Score = 68.6 bits (166), Expect = 9e-10 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -3 Query: 498 REPFQKFSMAKGVPKPRRGFGNSFQPAIDAPRLLPH 391 REPFQKFS AKG P P+RGFGNSFQPAIDAPRL PH Sbjct: 59 REPFQKFSKAKGKPGPKRGFGNSFQPAIDAPRLEPH 94 >ref|XP_002528203.1| conserved hypothetical protein [Ricinus communis] gi|223532415|gb|EEF34210.1| conserved hypothetical protein [Ricinus communis] Length = 51 Score = 67.0 bits (162), Expect = 3e-09 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -3 Query: 498 REPFQKFSMAKGVPKPRRGFGNSFQPAIDAPRLLPH 391 +EPFQKFS A+ VP+P+RGFGNSFQPAIDAPRL PH Sbjct: 16 KEPFQKFSKAEDVPRPKRGFGNSFQPAIDAPRLEPH 51 >ref|XP_003631036.1| hypothetical protein MTR_8g106450 [Medicago truncatula] gi|355525058|gb|AET05512.1| hypothetical protein MTR_8g106450 [Medicago truncatula] Length = 220 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +3 Query: 354 VKHLCAWGNDAANEVITEARQLLVENYFQTPS 449 +KHLCAWGND ANEVITEAR LLVENYFQTPS Sbjct: 181 LKHLCAWGNDVANEVITEARLLLVENYFQTPS 212 >ref|XP_003621634.1| Serine carboxypeptidase-like protein [Medicago truncatula] gi|355496649|gb|AES77852.1| Serine carboxypeptidase-like protein [Medicago truncatula] Length = 105 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +3 Query: 348 R*VKHLCAWGNDAANEVITEARQLLVENYFQTPS 449 R + HLCAWGNDAANEV+TEAR LLVENYFQTPS Sbjct: 72 RCLNHLCAWGNDAANEVLTEARLLLVENYFQTPS 105 >gb|AAC17621.1| Similar to seryl-tRNA synthetase gb|U10400 from S cerevisiae. EST gb|N96627 comes from this gene [Arabidopsis thaliana] Length = 573 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -3 Query: 498 REPFQKFSMAKGVPKPRRGFGNSFQPAIDAPRLLPH 391 REPFQKFS A+ +PRRGFGNSFQPAIDAPRL PH Sbjct: 538 REPFQKFSKAQDKLRPRRGFGNSFQPAIDAPRLRPH 573