BLASTX nr result
ID: Atractylodes22_contig00019868
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00019868 (253 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACY01928.1| hypothetical protein [Beta vulgaris] 60 2e-07 gb|AEV42261.1| hypothetical protein [Beta vulgaris] 56 3e-06 >gb|ACY01928.1| hypothetical protein [Beta vulgaris] Length = 1583 Score = 60.1 bits (144), Expect = 2e-07 Identities = 36/82 (43%), Positives = 44/82 (53%), Gaps = 6/82 (7%) Frame = +1 Query: 25 EPIHSVSPTRSQTGPLTGARGPMWGKPNP-----TSNRNPPKPVYT-PTSSTTGEIRRLT 186 +P S PT S P P P P TS +P KP T P + GEIRRL+ Sbjct: 279 KPTLSAKPTYSFNYPTQTHNTPYNQFPAPSHHSSTSINSPNKPKTTLPIAKPFGEIRRLS 338 Query: 187 DREFQNKREKGLCFRCDGKWSV 252 ++E Q KRE GLCFRCD KW++ Sbjct: 339 EKELQYKREHGLCFRCDEKWAI 360 >gb|AEV42261.1| hypothetical protein [Beta vulgaris] Length = 1396 Score = 56.2 bits (134), Expect = 3e-06 Identities = 23/37 (62%), Positives = 30/37 (81%) Frame = +1 Query: 142 YTPTSSTTGEIRRLTDREFQNKREKGLCFRCDGKWSV 252 + P + GEIRRL+++E Q+KRE+GLCFRCD KWSV Sbjct: 281 HIPIARPYGEIRRLSEKELQHKRERGLCFRCDDKWSV 317