BLASTX nr result
ID: Atractylodes22_contig00019860
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00019860 (226 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002509838.1| zinc finger protein, putative [Ricinus commu... 62 5e-08 ref|XP_002298018.1| predicted protein [Populus trichocarpa] gi|2... 62 6e-08 ref|XP_002279473.1| PREDICTED: E3 ubiquitin-protein ligase RHA1B... 60 1e-07 ref|XP_002278353.1| PREDICTED: E3 ubiquitin-protein ligase RHA1B... 60 1e-07 ref|XP_003633623.1| PREDICTED: uncharacterized protein LOC100257... 59 4e-07 >ref|XP_002509838.1| zinc finger protein, putative [Ricinus communis] gi|223549737|gb|EEF51225.1| zinc finger protein, putative [Ricinus communis] Length = 164 Score = 62.0 bits (149), Expect = 5e-08 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = -3 Query: 224 CRTPFIPDDLQDSFNERLWAASGIADYYGDSSLVSDL 114 CRTP IPDD+Q++FNERLWAASGI D+YGD S + L Sbjct: 128 CRTPVIPDDMQEAFNERLWAASGIPDFYGDYSQIGAL 164 >ref|XP_002298018.1| predicted protein [Populus trichocarpa] gi|222845276|gb|EEE82823.1| predicted protein [Populus trichocarpa] Length = 171 Score = 61.6 bits (148), Expect = 6e-08 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -3 Query: 224 CRTPFIPDDLQDSFNERLWAASGIADYYGDSSLVSD 117 CRTP IPDD+Q+SFNERLWAASGI D+YG+ S D Sbjct: 135 CRTPVIPDDMQESFNERLWAASGIPDFYGEYSQTPD 170 >ref|XP_002279473.1| PREDICTED: E3 ubiquitin-protein ligase RHA1B-like [Vitis vinifera] Length = 168 Score = 60.5 bits (145), Expect = 1e-07 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -3 Query: 224 CRTPFIPDDLQDSFNERLWAASGIADYYGDSS 129 CRTPFIPDD+Q++FNERLWAAS + D+YGD S Sbjct: 133 CRTPFIPDDMQEAFNERLWAASALPDFYGDYS 164 >ref|XP_002278353.1| PREDICTED: E3 ubiquitin-protein ligase RHA1B [Vitis vinifera] Length = 167 Score = 60.5 bits (145), Expect = 1e-07 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = -3 Query: 224 CRTPFIPDDLQDSFNERLWAASGIADYYGDSSLVSDL 114 CRTPF+PD++QD FN+RLWAASGI D+Y + VS L Sbjct: 131 CRTPFVPDEMQDEFNQRLWAASGITDFYSEYGTVSGL 167 >ref|XP_003633623.1| PREDICTED: uncharacterized protein LOC100257890 [Vitis vinifera] Length = 290 Score = 58.9 bits (141), Expect = 4e-07 Identities = 23/37 (62%), Positives = 29/37 (78%) Frame = -3 Query: 224 CRTPFIPDDLQDSFNERLWAASGIADYYGDSSLVSDL 114 CRTPF+PD++QD FN+RLW ASGI D+Y + VS L Sbjct: 254 CRTPFVPDEMQDEFNQRLWVASGITDFYSEYGTVSGL 290