BLASTX nr result
ID: Atractylodes22_contig00019751
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00019751 (914 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004161314.1| PREDICTED: ABC transporter G family member 3... 64 6e-08 ref|XP_004147284.1| PREDICTED: ABC transporter G family member 3... 64 6e-08 ref|XP_003543454.1| PREDICTED: ABC transporter G family member 3... 64 6e-08 ref|XP_002273792.1| PREDICTED: ABC transporter G family member 3... 64 6e-08 ref|XP_002523691.1| ATP-binding cassette transporter, putative [... 64 6e-08 >ref|XP_004161314.1| PREDICTED: ABC transporter G family member 3-like [Cucumis sativus] Length = 721 Score = 63.5 bits (153), Expect = 6e-08 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +2 Query: 824 FFYLRKPGALRQPISFEDSPDWEDTDVEVR 913 FFYLRKPG+LRQPISFEDSPDWE+TD++VR Sbjct: 30 FFYLRKPGSLRQPISFEDSPDWEETDIDVR 59 >ref|XP_004147284.1| PREDICTED: ABC transporter G family member 3-like [Cucumis sativus] Length = 721 Score = 63.5 bits (153), Expect = 6e-08 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +2 Query: 824 FFYLRKPGALRQPISFEDSPDWEDTDVEVR 913 FFYLRKPG+LRQPISFEDSPDWE+TD++VR Sbjct: 30 FFYLRKPGSLRQPISFEDSPDWEETDIDVR 59 >ref|XP_003543454.1| PREDICTED: ABC transporter G family member 3-like [Glycine max] Length = 724 Score = 63.5 bits (153), Expect = 6e-08 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +2 Query: 824 FFYLRKPGALRQPISFEDSPDWEDTDVEVR 913 FFYLRKPG+LRQPISFEDSP+WEDTD++VR Sbjct: 30 FFYLRKPGSLRQPISFEDSPEWEDTDIDVR 59 >ref|XP_002273792.1| PREDICTED: ABC transporter G family member 3 [Vitis vinifera] gi|297734935|emb|CBI17169.3| unnamed protein product [Vitis vinifera] Length = 722 Score = 63.5 bits (153), Expect = 6e-08 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +2 Query: 824 FFYLRKPGALRQPISFEDSPDWEDTDVEVR 913 FFYLRKPG+LRQPISFEDSP+WEDTD++VR Sbjct: 30 FFYLRKPGSLRQPISFEDSPEWEDTDIDVR 59 >ref|XP_002523691.1| ATP-binding cassette transporter, putative [Ricinus communis] gi|223536995|gb|EEF38631.1| ATP-binding cassette transporter, putative [Ricinus communis] Length = 722 Score = 63.5 bits (153), Expect = 6e-08 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +2 Query: 824 FFYLRKPGALRQPISFEDSPDWEDTDVEVR 913 FFYLRKPG+LRQPISFEDSP+WEDTD++VR Sbjct: 30 FFYLRKPGSLRQPISFEDSPEWEDTDIDVR 59