BLASTX nr result
ID: Atractylodes22_contig00019644
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00019644 (242 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|Q43175.1|CISY_SOLTU RecName: Full=Citrate synthase, mitochond... 55 5e-06 gb|AFL48183.1| citrate synthase [Capsicum annuum] 55 5e-06 emb|CAA59008.1| citrate synthase [Nicotiana tabacum] 55 6e-06 >sp|Q43175.1|CISY_SOLTU RecName: Full=Citrate synthase, mitochondrial; Flags: Precursor gi|483510|emb|CAA52976.1| ethanolamine ammonia-lyase [Solanum tuberosum] Length = 471 Score = 55.5 bits (132), Expect = 5e-06 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +1 Query: 142 MVFYRSVSLLSKLRNRVVQQPSLTNSVRWLQLQ 240 MVFYRSVSLLSKLR+R VQQ +++NSVRWLQ+Q Sbjct: 1 MVFYRSVSLLSKLRSRAVQQSNVSNSVRWLQVQ 33 >gb|AFL48183.1| citrate synthase [Capsicum annuum] Length = 470 Score = 55.5 bits (132), Expect = 5e-06 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +1 Query: 142 MVFYRSVSLLSKLRNRVVQQPSLTNSVRWLQLQ 240 MVFYRSVSLLSKLR+R VQQ +++NSVRWLQ+Q Sbjct: 1 MVFYRSVSLLSKLRSRAVQQSNVSNSVRWLQVQ 33 >emb|CAA59008.1| citrate synthase [Nicotiana tabacum] Length = 469 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +1 Query: 142 MVFYRSVSLLSKLRNRVVQQPSLTNSVRWLQLQ 240 MVFYR VSLLSKLR+R VQQ +L+NSVRWLQ+Q Sbjct: 1 MVFYRGVSLLSKLRSRAVQQTNLSNSVRWLQVQ 33