BLASTX nr result
ID: Atractylodes22_contig00019620
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00019620 (858 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002263471.1| PREDICTED: NEP1-interacting protein 1 [Vitis... 60 6e-07 >ref|XP_002263471.1| PREDICTED: NEP1-interacting protein 1 [Vitis vinifera] gi|296084057|emb|CBI24445.3| unnamed protein product [Vitis vinifera] Length = 235 Score = 60.1 bits (144), Expect = 6e-07 Identities = 30/51 (58%), Positives = 36/51 (70%) Frame = -3 Query: 526 MAFCLCPSHRLHFSSFPFANLVLELKDFFTPALSFVIGNVFSASFTFFFAL 374 M F PSH + SF FANLV ++DFF+ A S ++GNVFSA FTFFFAL Sbjct: 1 MEFYAYPSHSYSWPSFSFANLVGRVRDFFSFAFSAILGNVFSAIFTFFFAL 51