BLASTX nr result
ID: Atractylodes22_contig00019612
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00019612 (290 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002869696.1| hypothetical protein ARALYDRAFT_492340 [Arab... 58 7e-07 ref|NP_194227.2| histidine kinase-like ATPase domain-containing ... 58 9e-07 ref|XP_003532495.1| PREDICTED: uncharacterized protein LOC100816... 58 9e-07 ref|XP_003524472.1| PREDICTED: uncharacterized protein LOC100786... 58 9e-07 emb|CAB36739.1| putative protein [Arabidopsis thaliana] gi|72693... 58 9e-07 >ref|XP_002869696.1| hypothetical protein ARALYDRAFT_492340 [Arabidopsis lyrata subsp. lyrata] gi|297315532|gb|EFH45955.1| hypothetical protein ARALYDRAFT_492340 [Arabidopsis lyrata subsp. lyrata] Length = 709 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = -2 Query: 205 VLEADFIEPAHDKQGFELTTILQRLENQLVVIQKKYF 95 VLEA+F+EPAHDKQGFE TT+L RLE++LV +QK Y+ Sbjct: 517 VLEANFVEPAHDKQGFERTTVLSRLESRLVQMQKTYW 553 >ref|NP_194227.2| histidine kinase-like ATPase domain-containing protein [Arabidopsis thaliana] gi|332659583|gb|AEE84983.1| histidine kinase-like ATPase domain-containing protein [Arabidopsis thaliana] Length = 707 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = -2 Query: 205 VLEADFIEPAHDKQGFELTTILQRLENQLVVIQKKYF 95 VLEA+F+EPAHDKQGFE TT+L RLE++LV +QK Y+ Sbjct: 517 VLEANFVEPAHDKQGFERTTVLARLESRLVQMQKTYW 553 >ref|XP_003532495.1| PREDICTED: uncharacterized protein LOC100816702 [Glycine max] Length = 820 Score = 57.8 bits (138), Expect = 9e-07 Identities = 25/37 (67%), Positives = 33/37 (89%) Frame = -2 Query: 205 VLEADFIEPAHDKQGFELTTILQRLENQLVVIQKKYF 95 VLEA+F+EPAHDKQGFE T +L RLE++L+ +QKKY+ Sbjct: 509 VLEANFVEPAHDKQGFERTLVLSRLESKLIQMQKKYW 545 >ref|XP_003524472.1| PREDICTED: uncharacterized protein LOC100786679 [Glycine max] Length = 809 Score = 57.8 bits (138), Expect = 9e-07 Identities = 25/37 (67%), Positives = 33/37 (89%) Frame = -2 Query: 205 VLEADFIEPAHDKQGFELTTILQRLENQLVVIQKKYF 95 VLEA+F+EPAHDKQGFE T +L RLE++L+ +QKKY+ Sbjct: 544 VLEANFVEPAHDKQGFERTLVLSRLESKLIQMQKKYW 580 >emb|CAB36739.1| putative protein [Arabidopsis thaliana] gi|7269347|emb|CAB79406.1| putative protein [Arabidopsis thaliana] Length = 618 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = -2 Query: 205 VLEADFIEPAHDKQGFELTTILQRLENQLVVIQKKYF 95 VLEA+F+EPAHDKQGFE TT+L RLE++LV +QK Y+ Sbjct: 487 VLEANFVEPAHDKQGFERTTVLARLESRLVQMQKTYW 523