BLASTX nr result
ID: Atractylodes22_contig00019608
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00019608 (277 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002313579.1| predicted protein [Populus trichocarpa] gi|2... 60 1e-07 ref|XP_002263764.1| PREDICTED: UPF0712 protein C7orf64 homolog [... 57 2e-06 emb|CAN63941.1| hypothetical protein VITISV_032503 [Vitis vinifera] 57 2e-06 ref|XP_003616248.1| hypothetical protein MTR_5g077780 [Medicago ... 57 2e-06 ref|XP_002525357.1| nucleic acid binding protein, putative [Rici... 56 3e-06 >ref|XP_002313579.1| predicted protein [Populus trichocarpa] gi|222849987|gb|EEE87534.1| predicted protein [Populus trichocarpa] Length = 234 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +1 Query: 13 VSSNQDYFPLESMNQTVRLVREKLNKIESDAETLKAG 123 VSS+QDYFP +SMNQTVRLVREKLNKI+S +E L+AG Sbjct: 184 VSSDQDYFPSQSMNQTVRLVREKLNKIQSSSEHLQAG 220 >ref|XP_002263764.1| PREDICTED: UPF0712 protein C7orf64 homolog [Vitis vinifera] gi|297739067|emb|CBI28556.3| unnamed protein product [Vitis vinifera] Length = 230 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = +1 Query: 7 STVSSNQDYFPLESMNQTVRLVREKLNKIESDAETLKAG 123 +TVSSNQDYF SMNQTVRLVREKL+KI+S ++ L+AG Sbjct: 178 TTVSSNQDYFGSPSMNQTVRLVREKLDKIQSSSQHLEAG 216 >emb|CAN63941.1| hypothetical protein VITISV_032503 [Vitis vinifera] Length = 230 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = +1 Query: 7 STVSSNQDYFPLESMNQTVRLVREKLNKIESDAETLKAG 123 +TVSSNQDYF SMNQTVRLVREKL+KI+S ++ L+AG Sbjct: 178 TTVSSNQDYFGSPSMNQTVRLVREKLDKIQSSSQHLEAG 216 >ref|XP_003616248.1| hypothetical protein MTR_5g077780 [Medicago truncatula] gi|355517583|gb|AES99206.1| hypothetical protein MTR_5g077780 [Medicago truncatula] Length = 222 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = +1 Query: 10 TVSSNQDYFPLESMNQTVRLVREKLNKIESDAETLKAGSS 129 TVSSN+DYF SMNQTVR+VR+KL+KI+S E L+AGS+ Sbjct: 171 TVSSNEDYFSSHSMNQTVRVVRDKLDKIQSSGEHLQAGST 210 >ref|XP_002525357.1| nucleic acid binding protein, putative [Ricinus communis] gi|223535320|gb|EEF36995.1| nucleic acid binding protein, putative [Ricinus communis] Length = 216 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = +1 Query: 13 VSSNQDYFPLESMNQTVRLVREKLNKIESDAETLKA 120 VSSNQ+YFP +SMNQTV LVREKLNKI+S +E L+A Sbjct: 166 VSSNQEYFPSQSMNQTVSLVREKLNKIQSSSEHLQA 201