BLASTX nr result
ID: Atractylodes22_contig00019497
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00019497 (200 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI40483.3| unnamed protein product [Vitis vinifera] 72 5e-11 emb|CBI34458.3| unnamed protein product [Vitis vinifera] 72 5e-11 ref|XP_002271107.1| PREDICTED: uncharacterized protein LOC100243... 72 5e-11 ref|XP_002520886.1| hypothetical protein RCOM_0690150 [Ricinus c... 71 1e-10 ref|XP_002533909.1| hypothetical protein RCOM_0237030 [Ricinus c... 70 2e-10 >emb|CBI40483.3| unnamed protein product [Vitis vinifera] Length = 720 Score = 72.0 bits (175), Expect = 5e-11 Identities = 30/49 (61%), Positives = 38/49 (77%) Frame = +2 Query: 50 NTKVRLVRCPRCRNLLPELPDVPLYKCGGCGAVLQAKKRPNGTADTTSQ 196 + KVRLVRCP+C+++LPE PDVP+Y CG CGAVLQ KK DT+S+ Sbjct: 4 SAKVRLVRCPKCKHILPERPDVPVYLCGSCGAVLQGKKNRKSGVDTSSE 52 >emb|CBI34458.3| unnamed protein product [Vitis vinifera] Length = 712 Score = 72.0 bits (175), Expect = 5e-11 Identities = 29/38 (76%), Positives = 36/38 (94%) Frame = +2 Query: 53 TKVRLVRCPRCRNLLPELPDVPLYKCGGCGAVLQAKKR 166 +KVR+VRCP+C NLLPELPD P+Y+CGGCGAVL+AKK+ Sbjct: 5 SKVRVVRCPKCENLLPELPDYPVYQCGGCGAVLRAKKK 42 >ref|XP_002271107.1| PREDICTED: uncharacterized protein LOC100243335 [Vitis vinifera] Length = 956 Score = 72.0 bits (175), Expect = 5e-11 Identities = 29/38 (76%), Positives = 36/38 (94%) Frame = +2 Query: 53 TKVRLVRCPRCRNLLPELPDVPLYKCGGCGAVLQAKKR 166 +KVR+VRCP+C NLLPELPD P+Y+CGGCGAVL+AKK+ Sbjct: 5 SKVRVVRCPKCENLLPELPDYPVYQCGGCGAVLRAKKK 42 >ref|XP_002520886.1| hypothetical protein RCOM_0690150 [Ricinus communis] gi|223540017|gb|EEF41595.1| hypothetical protein RCOM_0690150 [Ricinus communis] Length = 878 Score = 70.9 bits (172), Expect = 1e-10 Identities = 29/46 (63%), Positives = 37/46 (80%) Frame = +2 Query: 56 KVRLVRCPRCRNLLPELPDVPLYKCGGCGAVLQAKKRPNGTADTTS 193 K+RLVRCP+CR++LPELPDVP+Y+CGGCG LQAK + TT+ Sbjct: 8 KIRLVRCPKCRHILPELPDVPVYECGGCGTRLQAKIKKENANSTTA 53 >ref|XP_002533909.1| hypothetical protein RCOM_0237030 [Ricinus communis] gi|223526130|gb|EEF28474.1| hypothetical protein RCOM_0237030 [Ricinus communis] Length = 916 Score = 69.7 bits (169), Expect = 2e-10 Identities = 32/50 (64%), Positives = 39/50 (78%) Frame = +2 Query: 50 NTKVRLVRCPRCRNLLPELPDVPLYKCGGCGAVLQAKKRPNGTADTTSQR 199 +TKVRLVRCP+C NLLPEL D +Y+CGGCGAVL+AK + N DT S + Sbjct: 4 STKVRLVRCPKCENLLPELADYSVYQCGGCGAVLRAKDK-NPDTDTVSHK 52