BLASTX nr result
ID: Atractylodes22_contig00019121
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00019121 (801 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003625939.1| Cellulose synthase-like protein D5 [Medicago... 67 5e-09 ref|XP_003521583.1| PREDICTED: cellulose synthase-like protein D... 65 1e-08 ref|XP_002523143.1| Cellulose synthase A catalytic subunit 3 [UD... 64 5e-08 ref|XP_002892121.1| hypothetical protein ARALYDRAFT_887416 [Arab... 63 9e-08 ref|NP_171773.1| 1,4-beta-D-xylan synthase [Arabidopsis thaliana... 63 9e-08 >ref|XP_003625939.1| Cellulose synthase-like protein D5 [Medicago truncatula] gi|355500954|gb|AES82157.1| Cellulose synthase-like protein D5 [Medicago truncatula] Length = 636 Score = 67.0 bits (162), Expect = 5e-09 Identities = 26/51 (50%), Positives = 44/51 (86%) Frame = -1 Query: 801 AKGLMGRKGKISTIVYLWSMLICIVVSLIFLYVHPPDGSRRQNFMMRFQFP 649 AKGL+GR+GK+ TI+Y+WS L+ I++S++++Y++PP G+R Q++ + FQFP Sbjct: 587 AKGLLGRRGKVPTIIYVWSGLLSIIISMLWVYINPPSGARPQDY-LNFQFP 636 >ref|XP_003521583.1| PREDICTED: cellulose synthase-like protein D5-like [Glycine max] Length = 1151 Score = 65.5 bits (158), Expect = 1e-08 Identities = 29/51 (56%), Positives = 43/51 (84%) Frame = -1 Query: 801 AKGLMGRKGKISTIVYLWSMLICIVVSLIFLYVHPPDGSRRQNFMMRFQFP 649 AKGLMGR+GK+ TI+Y+WS L+ I++SL+++Y++PP G R Q++ M FQFP Sbjct: 1103 AKGLMGRRGKVPTIIYVWSGLLSIIISLLWVYINPPSG-RTQDY-MNFQFP 1151 >ref|XP_002523143.1| Cellulose synthase A catalytic subunit 3 [UDP-forming], putative [Ricinus communis] gi|223537705|gb|EEF39328.1| Cellulose synthase A catalytic subunit 3 [UDP-forming], putative [Ricinus communis] Length = 1162 Score = 63.5 bits (153), Expect = 5e-08 Identities = 28/51 (54%), Positives = 43/51 (84%) Frame = -1 Query: 801 AKGLMGRKGKISTIVYLWSMLICIVVSLIFLYVHPPDGSRRQNFMMRFQFP 649 AKGLMGR+G++ TIVY+WS L+ I++SL+++Y+ PP G +Q++ M+FQFP Sbjct: 1115 AKGLMGRRGRVPTIVYVWSGLLSIIISLLWVYISPPSG--KQDY-MKFQFP 1162 >ref|XP_002892121.1| hypothetical protein ARALYDRAFT_887416 [Arabidopsis lyrata subsp. lyrata] gi|297337963|gb|EFH68380.1| hypothetical protein ARALYDRAFT_887416 [Arabidopsis lyrata subsp. lyrata] Length = 1184 Score = 62.8 bits (151), Expect = 9e-08 Identities = 28/51 (54%), Positives = 44/51 (86%) Frame = -1 Query: 801 AKGLMGRKGKISTIVYLWSMLICIVVSLIFLYVHPPDGSRRQNFMMRFQFP 649 AKGLMGR+G++ TIV++WS L+ I+VSL+++Y++PP G +Q++ M+FQFP Sbjct: 1137 AKGLMGRRGRVPTIVFVWSGLLSIIVSLLWVYINPPSG--KQDY-MQFQFP 1184 >ref|NP_171773.1| 1,4-beta-D-xylan synthase [Arabidopsis thaliana] gi|75207418|sp|Q9SRW9.1|CSLD5_ARATH RecName: Full=Cellulose synthase-like protein D5; Short=AtCslD5 gi|6056428|gb|AAF02892.1|AC009525_26 Very similar to cellulose synthase catalytic subunit [Arabidopsis thaliana] gi|332189343|gb|AEE27464.1| 1,4-beta-D-xylan synthase [Arabidopsis thaliana] Length = 1181 Score = 62.8 bits (151), Expect = 9e-08 Identities = 28/51 (54%), Positives = 44/51 (86%) Frame = -1 Query: 801 AKGLMGRKGKISTIVYLWSMLICIVVSLIFLYVHPPDGSRRQNFMMRFQFP 649 AKGLMGR+G++ TIV++WS L+ I+VSL+++Y++PP G +Q++ M+FQFP Sbjct: 1134 AKGLMGRRGRVPTIVFVWSGLLSIIVSLLWVYINPPSG--KQDY-MQFQFP 1181