BLASTX nr result
ID: Atractylodes22_contig00019093
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00019093 (404 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004162385.1| PREDICTED: uncharacterized protein LOC101229... 44 2e-06 ref|XP_004140606.1| PREDICTED: uncharacterized protein LOC101214... 44 2e-06 ref|XP_002518631.1| conserved hypothetical protein [Ricinus comm... 46 8e-06 >ref|XP_004162385.1| PREDICTED: uncharacterized protein LOC101229159 [Cucumis sativus] Length = 749 Score = 43.5 bits (101), Expect(2) = 2e-06 Identities = 19/31 (61%), Positives = 27/31 (87%) Frame = +3 Query: 51 FEFSRNQMHDAEEVALELIQELTCLRNILQR 143 FEFSRNQ+ DAEEVA +L++EL+ LR +L++ Sbjct: 648 FEFSRNQLQDAEEVASDLMKELSYLRGVLEK 678 Score = 32.7 bits (73), Expect(2) = 2e-06 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = +2 Query: 2 CNYLNCTSSRLHAERSF 52 CN LNC+S RLHAER+F Sbjct: 632 CNCLNCSSFRLHAERAF 648 >ref|XP_004140606.1| PREDICTED: uncharacterized protein LOC101214238 [Cucumis sativus] Length = 749 Score = 43.5 bits (101), Expect(2) = 2e-06 Identities = 19/31 (61%), Positives = 27/31 (87%) Frame = +3 Query: 51 FEFSRNQMHDAEEVALELIQELTCLRNILQR 143 FEFSRNQ+ DAEEVA +L++EL+ LR +L++ Sbjct: 648 FEFSRNQLQDAEEVASDLMKELSYLRGVLEK 678 Score = 32.7 bits (73), Expect(2) = 2e-06 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = +2 Query: 2 CNYLNCTSSRLHAERSF 52 CN LNC+S RLHAER+F Sbjct: 632 CNCLNCSSFRLHAERAF 648 >ref|XP_002518631.1| conserved hypothetical protein [Ricinus communis] gi|223542230|gb|EEF43773.1| conserved hypothetical protein [Ricinus communis] Length = 796 Score = 46.2 bits (108), Expect(2) = 8e-06 Identities = 21/30 (70%), Positives = 28/30 (93%) Frame = +3 Query: 51 FEFSRNQMHDAEEVALELIQELTCLRNILQ 140 FEFS+NQM DAEEVAL+LI+EL+ +RN+L+ Sbjct: 698 FEFSKNQMQDAEEVALDLIKELSHVRNMLE 727 Score = 28.1 bits (61), Expect(2) = 8e-06 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +2 Query: 2 CNYLNCTSSRLHAERSF 52 C L+C S RLHAER+F Sbjct: 682 CTCLDCASFRLHAERAF 698