BLASTX nr result
ID: Atractylodes22_contig00019001
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00019001 (375 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_193002.4| endomembrane family protein 70 [Arabidopsis tha... 59 4e-07 emb|CAB40983.1| putative protein (fragment) [Arabidopsis thaliana] 59 4e-07 ref|XP_002302834.1| predicted protein [Populus trichocarpa] gi|2... 55 6e-06 >ref|NP_193002.4| endomembrane family protein 70 [Arabidopsis thaliana] gi|332657760|gb|AEE83160.1| endomembrane family protein 70 [Arabidopsis thaliana] Length = 652 Score = 58.9 bits (141), Expect = 4e-07 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +3 Query: 267 LFTYVIFISLPCNGFYLPGSYMHTYSTRDEIFAKVN 374 +F ++F+S CNGFYLPGSYMHTYS D IFAKVN Sbjct: 7 VFVLLVFVSQLCNGFYLPGSYMHTYSDGDSIFAKVN 42 >emb|CAB40983.1| putative protein (fragment) [Arabidopsis thaliana] Length = 227 Score = 58.9 bits (141), Expect = 4e-07 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +3 Query: 267 LFTYVIFISLPCNGFYLPGSYMHTYSTRDEIFAKVN 374 +F ++F+S CNGFYLPGSYMHTYS D IFAKVN Sbjct: 7 VFVLLVFVSQLCNGFYLPGSYMHTYSDGDSIFAKVN 42 >ref|XP_002302834.1| predicted protein [Populus trichocarpa] gi|222844560|gb|EEE82107.1| predicted protein [Populus trichocarpa] Length = 650 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/39 (64%), Positives = 27/39 (69%) Frame = +3 Query: 258 CWLLFTYVIFISLPCNGFYLPGSYMHTYSTRDEIFAKVN 374 CW +F + CNGFYLPGSYMHTYS D IFAKVN Sbjct: 3 CWAFLLLALFGNA-CNGFYLPGSYMHTYSPGDAIFAKVN 40