BLASTX nr result
ID: Atractylodes22_contig00018941
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00018941 (1284 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283752.1| PREDICTED: polypyrimidine tract-binding prot... 65 5e-08 ref|XP_002283748.1| PREDICTED: polypyrimidine tract-binding prot... 65 5e-08 gb|ABK95931.1| unknown [Populus trichocarpa] 65 5e-08 ref|XP_002324068.1| predicted protein [Populus trichocarpa] gi|2... 64 6e-08 ref|XP_002976368.1| hypothetical protein SELMODRAFT_104811 [Sela... 63 2e-07 >ref|XP_002283752.1| PREDICTED: polypyrimidine tract-binding protein homolog 1 isoform 2 [Vitis vinifera] Length = 420 Score = 64.7 bits (156), Expect = 5e-08 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 1170 RYLLSEHVGSCHLRISYSAHTDLNIKFQSH 1081 RYLL EHVGSCHLRISYSAHTDLNIKFQSH Sbjct: 148 RYLLPEHVGSCHLRISYSAHTDLNIKFQSH 177 >ref|XP_002283748.1| PREDICTED: polypyrimidine tract-binding protein homolog 1 isoform 1 [Vitis vinifera] gi|296082938|emb|CBI22239.3| unnamed protein product [Vitis vinifera] Length = 449 Score = 64.7 bits (156), Expect = 5e-08 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 1170 RYLLSEHVGSCHLRISYSAHTDLNIKFQSH 1081 RYLL EHVGSCHLRISYSAHTDLNIKFQSH Sbjct: 177 RYLLPEHVGSCHLRISYSAHTDLNIKFQSH 206 >gb|ABK95931.1| unknown [Populus trichocarpa] Length = 473 Score = 64.7 bits (156), Expect = 5e-08 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 1170 RYLLSEHVGSCHLRISYSAHTDLNIKFQSH 1081 RYLL EHVGSCHLRISYSAHTDLNIKFQSH Sbjct: 177 RYLLPEHVGSCHLRISYSAHTDLNIKFQSH 206 >ref|XP_002324068.1| predicted protein [Populus trichocarpa] gi|222867070|gb|EEF04201.1| predicted protein [Populus trichocarpa] Length = 476 Score = 64.3 bits (155), Expect = 6e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 1173 FRYLLSEHVGSCHLRISYSAHTDLNIKFQSH 1081 FRYLL EHVGSC+LRISYSAHTDLNIKFQSH Sbjct: 180 FRYLLPEHVGSCNLRISYSAHTDLNIKFQSH 210 >ref|XP_002976368.1| hypothetical protein SELMODRAFT_104811 [Selaginella moellendorffii] gi|302811042|ref|XP_002987211.1| hypothetical protein SELMODRAFT_125500 [Selaginella moellendorffii] gi|300145108|gb|EFJ11787.1| hypothetical protein SELMODRAFT_125500 [Selaginella moellendorffii] gi|300155998|gb|EFJ22628.1| hypothetical protein SELMODRAFT_104811 [Selaginella moellendorffii] Length = 440 Score = 62.8 bits (151), Expect = 2e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 1170 RYLLSEHVGSCHLRISYSAHTDLNIKFQSH 1081 RYLL EHVGSCHLRIS+SAHTDLN+KFQSH Sbjct: 178 RYLLPEHVGSCHLRISFSAHTDLNVKFQSH 207