BLASTX nr result
ID: Atractylodes22_contig00018841
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00018841 (558 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACS83605.1| ATP synthase epsilon subunit 1 [Gossypium hirsutum] 133 2e-29 ref|XP_004141742.1| PREDICTED: ATP synthase subunit epsilon, mit... 131 8e-29 ref|XP_002517228.1| ATP synthase epsilon chain, mitochondrial, p... 130 1e-28 ref|NP_175576.1| ATP synthase subunit epsilon [Arabidopsis thali... 130 2e-28 ref|XP_002891649.1| ATP synthase epsilon chain, mitochondrial [A... 130 2e-28 >gb|ACS83605.1| ATP synthase epsilon subunit 1 [Gossypium hirsutum] Length = 70 Score = 133 bits (334), Expect = 2e-29 Identities = 59/68 (86%), Positives = 66/68 (97%) Frame = -3 Query: 460 MASSAAVPFWRSAGMTYISYSNICANLVRNCLKEPYKSEAISREKVHFSVSKWADGKPQK 281 M S+AAVPFWR+AGMTYI+YSNICANLVRNCLKEPYK+EA+SREKVHFS+SKW DGKP+K Sbjct: 1 MTSNAAVPFWRAAGMTYITYSNICANLVRNCLKEPYKTEALSREKVHFSISKWTDGKPEK 60 Query: 280 PTIRSDSP 257 PTIRSDSP Sbjct: 61 PTIRSDSP 68 >ref|XP_004141742.1| PREDICTED: ATP synthase subunit epsilon, mitochondrial-like [Cucumis sativus] Length = 70 Score = 131 bits (329), Expect = 8e-29 Identities = 58/68 (85%), Positives = 65/68 (95%) Frame = -3 Query: 460 MASSAAVPFWRSAGMTYISYSNICANLVRNCLKEPYKSEAISREKVHFSVSKWADGKPQK 281 MASSAAVPFWR+AGMTYI+YSNICANLVRNCLKEPYK+E + REKVHFSV+KW DGKPQK Sbjct: 1 MASSAAVPFWRAAGMTYITYSNICANLVRNCLKEPYKTEVLKREKVHFSVAKWVDGKPQK 60 Query: 280 PTIRSDSP 257 PT+RSD+P Sbjct: 61 PTLRSDTP 68 >ref|XP_002517228.1| ATP synthase epsilon chain, mitochondrial, putative [Ricinus communis] gi|223543599|gb|EEF45128.1| ATP synthase epsilon chain, mitochondrial, putative [Ricinus communis] Length = 70 Score = 130 bits (328), Expect = 1e-28 Identities = 58/68 (85%), Positives = 67/68 (98%) Frame = -3 Query: 460 MASSAAVPFWRSAGMTYISYSNICANLVRNCLKEPYKSEAISREKVHFSVSKWADGKPQK 281 MAS+AAVPFWR+AGMTYI+YSNICANLVRNCLKEP+K+EA++REKVHFSVSKW DGKPQK Sbjct: 1 MASNAAVPFWRAAGMTYITYSNICANLVRNCLKEPHKTEALTREKVHFSVSKWVDGKPQK 60 Query: 280 PTIRSDSP 257 PT+RSD+P Sbjct: 61 PTMRSDTP 68 >ref|NP_175576.1| ATP synthase subunit epsilon [Arabidopsis thaliana] gi|2493052|sp|Q96253.3|ATP5E_ARATH RecName: Full=ATP synthase subunit epsilon, mitochondrial; Short=ATPase subunit epsilon gi|12321688|gb|AAG50890.1|AC025294_28 epsilon subunit of mitochondrial F1-ATPase [Arabidopsis thaliana] gi|1655486|dbj|BAA13602.1| epsilon subunit of mitochondrial F1-ATPase [Arabidopsis thaliana] gi|18252167|gb|AAL61916.1| epsilon subunit of mitochondrial F1-ATPase [Arabidopsis thaliana] gi|21386911|gb|AAM47859.1| epsilon subunit of mitochondrial F1-ATPase [Arabidopsis thaliana] gi|332194574|gb|AEE32695.1| ATP synthase subunit epsilon [Arabidopsis thaliana] Length = 70 Score = 130 bits (326), Expect = 2e-28 Identities = 57/68 (83%), Positives = 67/68 (98%) Frame = -3 Query: 460 MASSAAVPFWRSAGMTYISYSNICANLVRNCLKEPYKSEAISREKVHFSVSKWADGKPQK 281 MAS+AAVPFWR+AGMTYISYSNICAN+VRNCLKEP+K+EA++REKVHFS+SKWADGKPQK Sbjct: 1 MASNAAVPFWRAAGMTYISYSNICANIVRNCLKEPHKAEALTREKVHFSLSKWADGKPQK 60 Query: 280 PTIRSDSP 257 P +RSD+P Sbjct: 61 PVLRSDTP 68 >ref|XP_002891649.1| ATP synthase epsilon chain, mitochondrial [Arabidopsis lyrata subsp. lyrata] gi|297337491|gb|EFH67908.1| ATP synthase epsilon chain, mitochondrial [Arabidopsis lyrata subsp. lyrata] Length = 70 Score = 130 bits (326), Expect = 2e-28 Identities = 57/68 (83%), Positives = 67/68 (98%) Frame = -3 Query: 460 MASSAAVPFWRSAGMTYISYSNICANLVRNCLKEPYKSEAISREKVHFSVSKWADGKPQK 281 MAS+AAVPFWR+AGMTYISYSNICAN+VRNCLKEP+K+EA++REKVHFS+SKWADGKPQK Sbjct: 1 MASNAAVPFWRAAGMTYISYSNICANIVRNCLKEPHKAEALTREKVHFSLSKWADGKPQK 60 Query: 280 PTIRSDSP 257 P +RSD+P Sbjct: 61 PVLRSDTP 68