BLASTX nr result
ID: Atractylodes22_contig00018556
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00018556 (244 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003634990.1| PREDICTED: uncharacterized protein LOC100852... 71 1e-10 emb|CAN81861.1| hypothetical protein VITISV_025557 [Vitis vinifera] 71 1e-10 ref|XP_002524556.1| conserved hypothetical protein [Ricinus comm... 58 7e-07 ref|XP_003548712.1| PREDICTED: uncharacterized protein LOC100812... 57 1e-06 >ref|XP_003634990.1| PREDICTED: uncharacterized protein LOC100852824 [Vitis vinifera] gi|296088838|emb|CBI38296.3| unnamed protein product [Vitis vinifera] Length = 518 Score = 70.9 bits (172), Expect = 1e-10 Identities = 35/51 (68%), Positives = 42/51 (82%) Frame = -3 Query: 164 MVHLFLSEPNWSWDGGDDSVKQRISLLNDLESIVHLLIASQSRSEARLWLC 12 MV L LSEP+WS G +DSVK RISLLN LESI+ LI+S++RSEAR+WLC Sbjct: 1 MVQLLLSEPSWSDGGDEDSVKLRISLLNKLESIICSLISSRARSEARVWLC 51 >emb|CAN81861.1| hypothetical protein VITISV_025557 [Vitis vinifera] Length = 514 Score = 70.9 bits (172), Expect = 1e-10 Identities = 35/51 (68%), Positives = 42/51 (82%) Frame = -3 Query: 164 MVHLFLSEPNWSWDGGDDSVKQRISLLNDLESIVHLLIASQSRSEARLWLC 12 MV L LSEP+WS G +DSVK RISLLN LESI+ LI+S++RSEAR+WLC Sbjct: 1 MVQLLLSEPSWSDGGDEDSVKLRISLLNKLESIICSLISSRARSEARVWLC 51 >ref|XP_002524556.1| conserved hypothetical protein [Ricinus communis] gi|223536109|gb|EEF37764.1| conserved hypothetical protein [Ricinus communis] Length = 405 Score = 58.2 bits (139), Expect = 7e-07 Identities = 33/58 (56%), Positives = 38/58 (65%), Gaps = 4/58 (6%) Frame = -3 Query: 164 MVHLFLSEPNWSWDGGD---DSVKQRISLLNDLESIVHLLI-ASQSRSEARLWLCKDL 3 MVHL LS+PNW + GD D KQ + LLN LESI+ LI A RSEARLWLC + Sbjct: 1 MVHLLLSKPNWKEEDGDRDSDLGKQWVLLLNKLESIIWSLINAGGGRSEARLWLCSSI 58 >ref|XP_003548712.1| PREDICTED: uncharacterized protein LOC100812984 [Glycine max] Length = 504 Score = 57.4 bits (137), Expect = 1e-06 Identities = 29/52 (55%), Positives = 38/52 (73%), Gaps = 1/52 (1%) Frame = -3 Query: 164 MVHLFLSEPNWS-WDGGDDSVKQRISLLNDLESIVHLLIASQSRSEARLWLC 12 M+ LFLSEPNW+ DDS + RIS+LNDLE+++ ++ RSEARLWLC Sbjct: 1 MIELFLSEPNWNDVVNDDDSTRSRISILNDLETVIW---STVGRSEARLWLC 49