BLASTX nr result
ID: Atractylodes22_contig00018481
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00018481 (253 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN70078.1| hypothetical protein VITISV_001036 [Vitis vinifera] 61 1e-07 >emb|CAN70078.1| hypothetical protein VITISV_001036 [Vitis vinifera] Length = 773 Score = 60.8 bits (146), Expect = 1e-07 Identities = 25/68 (36%), Positives = 38/68 (55%) Frame = -2 Query: 249 STPKHWATHRPITIGFVDGNHYVSVTLEGGYPMPTIYSQWFYRRDPCAEGWATPYHARLQ 70 S P R ++IGF++ NH+V + + G PMP + + W PCAEGWATPY A + Sbjct: 692 SAPTPLPMRRVLSIGFINDNHFVEILMTTGAPMPPVANSWSKSCYPCAEGWATPYAAYIN 751 Query: 69 QYTNYIES 46 + + + Sbjct: 752 MFHGLVSN 759