BLASTX nr result
ID: Atractylodes22_contig00018347
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00018347 (568 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAB75932.1| putative protein [Arabidopsis thaliana] 63 4e-08 emb|CAN65188.1| hypothetical protein VITISV_004365 [Vitis vinifera] 62 7e-08 emb|CAN79845.1| hypothetical protein VITISV_027568 [Vitis vinifera] 60 2e-07 gb|AAG51247.1|AC055769_6 copia-type polyprotein, putative; 28768... 60 3e-07 dbj|BAB11200.1| copia-type polyprotein [Arabidopsis thaliana] gi... 60 3e-07 >emb|CAB75932.1| putative protein [Arabidopsis thaliana] Length = 1339 Score = 62.8 bits (151), Expect = 4e-08 Identities = 26/46 (56%), Positives = 37/46 (80%) Frame = -2 Query: 138 QKKYAPEVLRRFGMDNCNAVYNPLIAGSKISKDDDGESIDSTNYKQ 1 Q++YA EVL RFGMD NAV NP++ G+K++KD++GE +D T +KQ Sbjct: 1072 QRRYAREVLARFGMDESNAVKNPIVPGTKLTKDENGEKVDETMFKQ 1117 >emb|CAN65188.1| hypothetical protein VITISV_004365 [Vitis vinifera] Length = 1265 Score = 62.0 bits (149), Expect = 7e-08 Identities = 27/46 (58%), Positives = 35/46 (76%) Frame = -2 Query: 138 QKKYAPEVLRRFGMDNCNAVYNPLIAGSKISKDDDGESIDSTNYKQ 1 QKKYA EVL+RFGMD N+V+NP++ G K+ KD+ G +D T YKQ Sbjct: 1028 QKKYALEVLQRFGMDKSNSVHNPIVPGFKLMKDEGGVKVDKTYYKQ 1073 >emb|CAN79845.1| hypothetical protein VITISV_027568 [Vitis vinifera] Length = 1226 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/46 (56%), Positives = 34/46 (73%) Frame = -2 Query: 138 QKKYAPEVLRRFGMDNCNAVYNPLIAGSKISKDDDGESIDSTNYKQ 1 +KKYA EVL RFGMD N+V+NP++ G K+ KD+ G +D T YKQ Sbjct: 961 KKKYALEVLNRFGMDKSNSVFNPIVPGCKLVKDEGGVKVDKTYYKQ 1006 >gb|AAG51247.1|AC055769_6 copia-type polyprotein, putative; 28768-32772 [Arabidopsis thaliana] Length = 1334 Score = 59.7 bits (143), Expect = 3e-07 Identities = 24/60 (40%), Positives = 44/60 (73%), Gaps = 2/60 (3%) Frame = -2 Query: 174 GHQNLRDEAGGY--QKKYAPEVLRRFGMDNCNAVYNPLIAGSKISKDDDGESIDSTNYKQ 1 G + ++DE G + Q+KYA E+++++GM+ CN+V NP++ G K++K G+++D T +KQ Sbjct: 1057 GVEVIQDERGIFINQRKYAAEIIKKYGMEGCNSVKNPIVPGQKLTKAGAGDAVDPTEFKQ 1116 >dbj|BAB11200.1| copia-type polyprotein [Arabidopsis thaliana] gi|13872710|emb|CAC37622.1| polyprotein [Arabidopsis thaliana] Length = 1334 Score = 59.7 bits (143), Expect = 3e-07 Identities = 24/60 (40%), Positives = 44/60 (73%), Gaps = 2/60 (3%) Frame = -2 Query: 174 GHQNLRDEAGGY--QKKYAPEVLRRFGMDNCNAVYNPLIAGSKISKDDDGESIDSTNYKQ 1 G + ++DE G + Q+KYA E+++++GM+ CN+V NP++ G K++K G+++D T +KQ Sbjct: 1057 GVEVIQDERGIFINQRKYAAEIIKKYGMEGCNSVKNPIVPGQKLTKAGAGDAVDPTEFKQ 1116