BLASTX nr result
ID: Atractylodes22_contig00018306
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00018306 (302 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282242.1| PREDICTED: 6-hydroxynicotinate 3-monooxygena... 56 3e-06 >ref|XP_002282242.1| PREDICTED: 6-hydroxynicotinate 3-monooxygenase [Vitis vinifera] Length = 424 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = +3 Query: 3 QGLVLAEGKVFDPNTATPEECRDLQQKNMPGFDEMPLVFNS 125 QGL+LA+ K FDP TA+ E+C +LQQKNMP F ++PL NS Sbjct: 384 QGLILADRKPFDPKTASLEDCEELQQKNMPFFADIPLPLNS 424